# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  pfam_list/DNA_methylase.hmm.txt
# target sequence database:        proteomes/Thermococcus_kodakarensis.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       DNA_methylase  [M=335]
Accession:   PF00145.17
Description: C-5 cytosine-specific DNA methylase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
     0.0022   14.5   0.0     0.0035   13.8   0.0    1.2  1  tr|Q5JD70|Q5JD70_THEKO  Met-10+ like protein OS=Thermococcus 
     0.0027   14.2   0.0     0.0038   13.7   0.0    1.2  1  tr|Q5JEI4|Q5JEI4_THEKO  tRNA(Phe) (4-demethylwyosine(37)-C(7)
     0.0088   12.5   0.1      0.018   11.5   0.0    1.5  2  tr|Q5JJ78|Q5JJ78_THEKO  Probable tRNA/rRNA methyltransferase 
  ------ inclusion threshold ------
       0.01   12.3   0.0      0.015   11.7   0.0    1.1  1  tr|Q5JDP7|Q5JDP7_THEKO  Predicted DNA methylase OS=Thermococc


Domain annotation for each sequence (and alignments):
>> tr|Q5JD70|Q5JD70_THEKO  Met-10+ like protein OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   13.8   0.0     6e-06    0.0035       3      54 ..     185     242 ..     184     258 .. 0.84

  Alignments for each domain:
  == domain 1  score: 13.8 bits;  conditional E-value: 6e-06
                             EEEES-TT-HHHHHHHHTT-EEEEEEE--TTTHHHHHHH-........-SEEEES-TTT CS
           DNA_methylase   3 fidLfaGiGGfrlgleaagfecvaaseidkkaaktYeanfk.......kvsigDitkid 54 
                             ++d+faG+G  ++ l+++  + v+a +i+++a+  +e n+k        +++gD++k++
  tr|Q5JD70|Q5JD70_THEKO 185 VFDMFAGVGPYSILLAKKA-KLVFACDINPWAVRYLEENKKlnktpnvIPILGDVRKVA 242
                             58***********999887.********************9987776666778888776 PP

>> tr|Q5JEI4|Q5JEI4_THEKO  tRNA(Phe) (4-demethylwyosine(37)-C(7)) aminocarboxypropyltransferase OS=Thermococcus kodakare
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   13.7   0.0   6.6e-06    0.0038       3      43 ..     129     169 ..     128     200 .. 0.73

  Alignments for each domain:
  == domain 1  score: 13.7 bits;  conditional E-value: 6.6e-06
                             EEEES-TT-HHHHHHHHTT-EEEEEEE--TTTHHHHHHH-. CS
           DNA_methylase   3 fidLfaGiGGfrlgleaagfecvaaseidkkaaktYeanfk 43 
                             ++d+faGiG ++l +   ++  v+a+e+d++ + ++  n+ 
  tr|Q5JEI4|Q5JEI4_THEKO 129 VVDMFAGIGHLSLPMTVHKGARVIAIEKDPYTFRFLVENIW 169
                             69*****************************9999988765 PP

>> tr|Q5JJ78|Q5JJ78_THEKO  Probable tRNA/rRNA methyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.7   0.0      0.63   3.6e+02     232     232 ..     111     111 ..      57     179 .. 0.53
   2 !   11.5   0.0   3.1e-05     0.018       1      48 [.     219     267 ..     219     292 .. 0.87

  Alignments for each domain:
  == domain 1  score: -2.7 bits;  conditional E-value: 0.63
                             H CS
           DNA_methylase 232 e 232
                              
  tr|Q5JJ78|Q5JJ78_THEKO 111 G 111
                             0 PP

  == domain 2  score: 11.5 bits;  conditional E-value: 3.1e-05
                             -EEEEES-TT-HHHHHHHHTT-EEEEEEE--TTTHHHHHHH-..-SEEE CS
           DNA_methylase   1 lkfidLfaGiGGfrlgleaagfecvaaseidkkaaktYeanfk.kvsig 48 
                             ++++d f + GGf++  + ag + v+a+++ ++a+++ + n k + ++ 
  tr|Q5JJ78|Q5JJ78_THEKO 219 MRVLDVFTYTGGFAIHAAVAGADEVVAVDKSPWAINMVKENAKlNGVED 267
                             799************************************9997655444 PP

>> tr|Q5JDP7|Q5JDP7_THEKO  Predicted DNA methylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.7   0.0   2.6e-05     0.015       3      70 ..      51     121 ..      50     121 .. 0.79

  Alignments for each domain:
  == domain 1  score: 11.7 bits;  conditional E-value: 2.6e-05
                             EEEES-TT-HHHHHHHHTT-EEEEEEE--TTTHHHHHHH-.-SEEEE.S-TTTS-..GS--.-SEEEE--- CS
           DNA_methylase   3 fidLfaGiGGfrlgleaagfecvaaseidkkaaktYeanfkkvsigD.itkidkk..klpediDlLvgGfP 70 
                             + dL aG G + +g    g e v+a+e dk+a ++ + n ++   +D i+ ++ +  +++ ++D ++  +P
  tr|Q5JDP7|Q5JDP7_THEKO  51 IADLGAGTGVLGIGAVLLGAENVYAVERDKEALEIARENARSLGVEDkIEFVNADvsEFSVNVDTVIMNPP 121
                             579*************************************9554444145444446677767887776665 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                              1  (335 nodes)
Target sequences:                         2301  (637680 residues searched)
Passed MSV filter:                       106  (0.0460669); expected 46.0 (0.02)
Passed bias filter:                       88  (0.0382442); expected 46.0 (0.02)
Passed Vit filter:                        10  (0.00434594); expected 2.3 (0.001)
Passed Fwd filter:                         4  (0.00173837); expected 0.0 (1e-05)
Initial search space (Z):               2301  [actual number of targets]
Domain search space  (domZ):               4  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 21362.28
//
[ok]