# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file: pfam_list/DREV.hmm.txt
# target sequence database: proteomes/Saccharomyces_cerevisiae.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query: DREV [M=265]
Accession: PF05219.11
Description: DREV methyltransferase
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
0.00077 17.1 0.0 0.0013 16.4 0.0 1.3 1 sp|P27680|COQ3_YEAST Ubiquinone biosynthesis O-methyltransfe
0.0033 15.0 0.0 0.0051 14.4 0.0 1.2 1 sp|P38347|EFM2_YEAST Protein-lysine N-methyltransferase EFM2
------ inclusion threshold ------
0.016 12.7 0.0 0.027 12.0 0.0 1.3 1 sp|P38892|CRG1_YEAST Probable S-adenosylmethionine-dependent
0.027 12.0 0.0 0.045 11.3 0.0 1.3 1 sp|P47163|EFM3_YEAST Protein-lysine N-methyltransferase EFM3
Domain annotation for each sequence (and alignments):
>> sp|P27680|COQ3_YEAST Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 16.4 0.0 8.6e-07 0.0013 93 182 .. 121 221 .. 103 229 .. 0.67
Alignments for each domain:
== domain 1 score: 16.4 bits; conditional E-value: 8.6e-07
DREV 93 qedkklldlGaGdGeitkrvap..tfee...........vyatelsetmrdrlkkkkynvlsalelqetdvkldlilclnlldrcfdpl 168
+ ++ +ld+G G G +++ +a +++ + a e +++ k +y+ + l++ ++d+i+c+++l+ + p
sp|P27680|COQ3_YEAST 121 RPEVSVLDVGCGGGILSESLARlkWVKNvqgidltrdciMVAKEHAKKDPMLEGKINYECKA---LEDVTGQFDIITCMEMLEHVDMPS 206
34679************999852257774444444444333333333333333334444333...4455579***************** PP
DREV 169 klledirsalep.ng 182
++l+ +s l+p +g
sp|P27680|COQ3_YEAST 207 EILRHCWSRLNPeKG 221
********9999444 PP
>> sp|P38347|EFM2_YEAST Protein-lysine N-methyltransferase EFM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 14.4 0.0 3.4e-06 0.0051 63 130 .. 218 289 .. 190 317 .. 0.74
Alignments for each domain:
== domain 1 score: 14.4 bits; conditional E-value: 3.4e-06
DREV 63 GllgrGsmfvlseeqfrkl...laie.kespasdqedkklldlGaGdGeitkrvaptfeevyatelsetmrd 130
G Gs ++ls+ +l + + ++ +sd ++ k+l+lGaG G + a +e+y te e
sp|P38347|EFM2_YEAST 218 GWKTWGSSLILSQLVVDHLdylHTTNvNMLANSDIKQIKVLELGAGTGLVGLSWALKWKELYGTENIEIFVT 289
556667777777644443311023331245699***************************999998766555 PP
>> sp|P38892|CRG1_YEAST Probable S-adenosylmethionine-dependent methyltransferase CRG1 OS=Saccharomyces cerevisiae (str
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? 12.0 0.0 1.8e-05 0.027 93 130 .. 37 74 .. 25 85 .. 0.84
Alignments for each domain:
== domain 1 score: 12.0 bits; conditional E-value: 1.8e-05
DREV 93 qedkklldlGaGdGeitkrvaptfeevyatelsetmrd 130
+ k l+d+G G G+ t v+p+f+ev + s+ m
sp|P38892|CRG1_YEAST 37 GTRKSLVDIGCGTGKATFVVEPYFKEVIGIDPSSAMLS 74
46789***************************999976 PP
>> sp|P47163|EFM3_YEAST Protein-lysine N-methyltransferase EFM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? 11.3 0.0 3e-05 0.045 90 152 .. 162 228 .. 146 232 .. 0.78
Alignments for each domain:
== domain 1 score: 11.3 bits; conditional E-value: 3e-05
DREV 90 asdqedkklldlGaGdGeitkrvaptfee....vyatelsetmrdrlkkkkynvlsalelqetdvkl 152
+ ++++ ++l++GaG G ++ + + ++e +y t+ +++ + k+++++ ++ +e d+kl
sp|P47163|EFM3_YEAST 162 DDGKKKLNVLEVGAGTGIVSLVILQKYHEfvnkMYVTDGDSNLVETQLKRNFELNNEVRENEPDIKL 228
45678899**********998775544444444*****99999998889999988887777777766 PP
Internal pipeline statistics summary:
-------------------------------------
Query model(s): 1 (265 nodes)
Target sequences: 6049 (2936363 residues searched)
Passed MSV filter: 181 (0.0299223); expected 121.0 (0.02)
Passed bias filter: 99 (0.0163663); expected 121.0 (0.02)
Passed Vit filter: 15 (0.00247975); expected 6.0 (0.001)
Passed Fwd filter: 4 (0.000661266); expected 0.1 (1e-05)
Initial search space (Z): 6049 [actual number of targets]
Domain search space (domZ): 4 [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.02
# Mc/sec: 38906.81
//
[ok]