# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file: pfam_list/GCD14.hmm.txt
# target sequence database: proteomes/Pseudomonas_aeruginosa.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query: GCD14 [M=247]
Accession: PF08704.9
Description: tRNA methyltransferase complex GCD14 subunit
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.4e-05 23.3 0.0 2.9e-05 22.2 0.0 1.5 2 sp|Q9HUC0|UBIE_PSEAE Ubiquinone/menaquinone biosynthesis C
0.0032 15.5 0.0 0.0045 15.0 0.0 1.2 1 tr|Q9HY94|Q9HY94_PSEAE Uncharacterized protein OS=Pseudomona
Domain annotation for each sequence (and alignments):
>> sp|Q9HUC0|UBIE_PSEAE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 22.2 0.0 1e-08 2.9e-05 38 141 .. 66 170 .. 58 178 .. 0.84
2 ? -0.1 0.0 0.069 1.9e+02 57 75 .. 160 178 .. 157 186 .. 0.88
Alignments for each domain:
== domain 1 score: 22.2 bits; conditional E-value: 1e-08
GCD14 38 lkpGsvvvesGtGsgslshaiartvaPtGhlftfefheqraekareefrehelsqlvtvthrDvckeGf.deevsgkvDavfL.DlPaP 124
++ G +v++ G+g l+ +++r v+PtG + + ++ + r+++ ++++s++v + D+ k f d++ + + a L ++
sp|Q9HUC0|UBIE_PSEAE 66 VRSGNRVLDIAGGTGDLTRQFSRLVGPTGEVVLADINASMLKVGRDKLLDKGVSGNVSFVQADAEKLPFpDNHFDCVTIAFGLrNVTHK 154
899******************************************************************66666554444444367888 PP
GCD14 125 weaiphaakalkkeggr 141
+eai ++ ++l k ggr
sp|Q9HUC0|UBIE_PSEAE 155 DEAIRSMLRVL-KPGGR 170
88888888888.44555 PP
== domain 2 score: -0.1 bits; conditional E-value: 0.069
GCD14 57 aiartvaPtGhlftfefhe 75
+++r ++P G+l +ef +
sp|Q9HUC0|UBIE_PSEAE 160 SMLRVLKPGGRLLVLEFSK 178
789*************975 PP
>> tr|Q9HY94|Q9HY94_PSEAE Uncharacterized protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 15.0 0.0 1.6e-06 0.0045 37 101 .. 173 236 .. 164 278 .. 0.79
Alignments for each domain:
== domain 1 score: 15.0 bits; conditional E-value: 1.6e-06
GCD14 37 elkpGsvvvesGtGsgslshaiartvaPtGhlftfefheqraekareefrehelsqlvtvthrDv 101
+l+ G v++ G Gsg + +a++ P +++ +fh+ +e+ar + + ++ + v ++ D
tr|Q9HY94|Q9HY94_PSEAE 173 KLQAGGSVLDFGCGSGLAAIMMAKA-FPEAQVYGCDFHAPSIERARANAEAAGVGDRVRFEVSDS 236
7899***********9776666666.6**************************999888777664 PP
Internal pipeline statistics summary:
-------------------------------------
Query model(s): 1 (247 nodes)
Target sequences: 5563 (1857172 residues searched)
Passed MSV filter: 109 (0.0195937); expected 111.3 (0.02)
Passed bias filter: 102 (0.0183354); expected 111.3 (0.02)
Passed Vit filter: 11 (0.00197735); expected 5.6 (0.001)
Passed Fwd filter: 2 (0.000359518); expected 0.1 (1e-05)
Initial search space (Z): 5563 [actual number of targets]
Domain search space (domZ): 2 [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 22936.07
//
[ok]