# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file: pfam_list/Gcd10p.hmm.txt
# target sequence database: proteomes/Ciona_intestinalis.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query: Gcd10p [M=300]
Accession: PF04189.12
Description: Gcd10p family
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-64 217.9 0.3 1.9e-64 217.6 0.3 1.1 1 tr|F7B480|F7B480_CIOIN Uncharacterized protein OS=Ciona inte
------ inclusion threshold ------
0.03 13.4 0.0 0.042 12.9 0.0 1.2 1 tr|H2XSX6|H2XSX6_CIOIN tRNA (adenine(58)-N(1))-methyltransfe
Domain annotation for each sequence (and alignments):
>> tr|F7B480|F7B480_CIOIN Uncharacterized protein OS=Ciona intestinalis OX=7719 GN=LOC100185737 PE=4 SV=2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 217.6 0.3 2.2e-68 1.9e-64 2 271 .. 7 264 .. 6 297 .. 0.91
Alignments for each domain:
== domain 1 score: 217.6 bits; conditional E-value: 2.2e-68
Gcd10p 2 IkpnqhvllkLpsenlkivqvkpnttisLgKfgsfplnliigrpygltfeildkreeeeksrlrvvpaaeleaeslaeeeaeeeeee 88
I+ n++v+l+ + +lk v+++ n+ i ++K + f+ ++++g +yg+ f++ + ++ + r + + e e ++ + ++ ++++++
tr|F7B480|F7B480_CIOIN 7 INLNTTVILE-RNSVLKAVKLVANKVIVFEKLR-FKPDKAVGCNYGTVFKVTLTPQRSSPWCKRTIANGEMEITDQDLDSLDTNADD 91
7899******.666*******************.*****************999988888889***999999999988888999999 PP
Gcd10p 89 eeardnreiid.dgarQkLtkeeIeeLKkegasagkeiIaklleshtafdqKTaFSqeKYlkrKkkKYlkrftvlpldvsllleyll 174
++++dnr+++d +g++Q++++e+I e+K ega+ g+ei++ l+e++++f++KT+FSq+KYlk+KkkKYl+++++++++++l+++ +
tr|F7B480|F7B480_CIOIN 92 AQGKDNRSLVDtHGKSQTIKRENILEMKGEGAT-GEEIVKCLVENSSSFNEKTSFSQNKYLKKKKKKYLSYIRIQRPNSRLICQLYQ 177
99*********7788******************.***************************************************** PP
Gcd10p 175 ekkdaqkilelreetlglllslanvhaggryLvvDdtgGLlvaalaeRmgifessakegtitliheneq.pnlsllkyfnydaaepe 260
e ++++ki+++r et++++l+ an+++g ++ vv++++G+++++++e++g+ +g+++ +h++e+ pnl ++ +fn+ pe
tr|F7B480|F7B480_CIOIN 178 E-REPAKICNMRMETMSQILTAANIKHGCNVGVVETCSGVVLGSVLEKLGG------KGCVVNLHNGESpPNLFAISHFNF----PE 253
*.9************************************************......************9***********....43 PP
Gcd10p 261 hplkkhlktls 271
+k + ++
tr|F7B480|F7B480_CIOIN 254 PDSDKSDNDIT 264
33333333333 PP
>> tr|H2XSX6|H2XSX6_CIOIN tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A OS=Ciona intestinalis OX=
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? 12.9 0.0 5e-06 0.042 2 52 .. 10 59 .. 9 63 .. 0.90
Alignments for each domain:
== domain 1 score: 12.9 bits; conditional E-value: 5e-06
Gcd10p 2 IkpnqhvllkLpsenlkivqvkpnttisLgKfgsfplnliigrpygltfei 52
+++++ v++ + ++++ + vk+++ is Kfg+++ ++ii+++yg+ f
tr|H2XSX6|H2XSX6_CIOIN 10 VEAGDIVIIFMGHDSMFPLYVKKGE-ISQTKFGAIKHDQIINHKYGTKFTC 59
7889999999999999999998776.9*********************986 PP
Internal pipeline statistics summary:
-------------------------------------
Query model(s): 1 (300 nodes)
Target sequences: 16678 (5370518 residues searched)
Passed MSV filter: 1035 (0.0620578); expected 333.6 (0.02)
Passed bias filter: 327 (0.0196067); expected 333.6 (0.02)
Passed Vit filter: 27 (0.0016189); expected 16.7 (0.001)
Passed Fwd filter: 2 (0.000119918); expected 0.2 (1e-05)
Initial search space (Z): 16678 [actual number of targets]
Domain search space (domZ): 2 [number of targets reported over threshold]
# CPU time: 0.13u 0.00s 00:00:00.13 Elapsed: 00:00:00.04
# Mc/sec: 40278.89
//
[ok]