# hmmsearch :: search profile(s) against a sequence database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: pfam_list/Gcd10p.hmm.txt # target sequence database: proteomes/Danio_rerio.fasta # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: Gcd10p [M=300] Accession: PF04189.12 Description: Gcd10p family Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-72 245.0 0.1 1.9e-72 244.4 0.1 1.3 1 tr|F1QFE5|F1QFE5_DANRE tRNA (adenine(58)-N(1))-methyltr ------ inclusion threshold ------ 0.14 11.7 0.0 0.25 10.9 0.0 1.3 1 tr|A0A0R4IR49|A0A0R4IR49_DANRE Si:ch211-165e15.1 OS=Danio rerio Domain annotation for each sequence (and alignments): >> tr|F1QFE5|F1QFE5_DANRE tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Danio rerio OX=7955 G # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 244.4 0.1 1.5e-76 1.9e-72 2 292 .. 14 284 .. 13 294 .. 0.86 Alignments for each domain: == domain 1 score: 244.4 bits; conditional E-value: 1.5e-76 Gcd10p 2 IkpnqhvllkLpsenlkivqvkpnttisLgKfgsfplnliigrpygltfeildkreeeeksrlrvvpaaeleaeslaeeeaeeeeee 88 I+ +++v+lk e++k vqv++++++ ++K++ f +++++g+ yg++fei+ + ++ ++v ++ +sl+++ea tr|F1QFE5|F1QFE5_DANRE 14 IAYGDYVVLK-RGEVFKSVQVENKKKVIFEKQW-FFMDNAVGQLYGTMFEIVAGGSLKH----KPV---KRAGDSLDSKEA------ 85 899*******.677*******************.*********************6644....345...777888887765...... PP Gcd10p 89 eeardnreiiddgarQkLtkeeIeeLKkegasagkeiIaklleshtafdqKTaFSqeKYlkrKkkKYlkrftvlpldvsllleylle 175 ++dnr+i+ddg++QkLt+++Ie+LK++g + g+ei+++l++++t+f++KT+F+qeKY+k+KkkKY + +tvl+++++ll+ +++ tr|F1QFE5|F1QFE5_DANRE 86 --GQDNRHIVDDGRSQKLTRDDIETLKEQGLK-GQEIVQQLIDNSTTFKDKTEFAQEKYIKKKKKKYESDITVLKPSTRLLAMMYHG 169 ..89****************************.****************************************************** PP Gcd10p 176 kkdaqkilelreetlglllslanvhaggryLvvDdtgGLlvaalaeRmgifessakegtitliheneqpnlsllkyfnydaaepehp 262 ++++ki++lr +tl+++l+l+n+hag++++v+++++GL++++++eRmg+ g++++++++ p + ++ f++ p+h+ tr|F1QFE5|F1QFE5_DANRE 170 -REPGKICHLRYDTLAQMLTLGNIHAGSKIIVFETCAGLVLGSVMERMGG------FGSVIQMFPGGGPTRAGMESFGF----PSHF 245 .9************************************************......***********************....8888 PP Gcd10p 263 lkkh....lktlswl.......qllepeedetyeeepeevs 292 ++ l + +l e++++++ +ee++ + tr|F1QFE5|F1QFE5_DANRE 246 HQTLhefpLCKV--NavlagklDLSEKDTENSRSEETAAEK 284 886422222222..222343334444444444444444333 PP >> tr|A0A0R4IR49|A0A0R4IR49_DANRE Si:ch211-165e15.1 OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 10.9 0.0 1.9e-05 0.25 165 215 .. 500 552 .. 493 611 .. 0.89 Alignments for each domain: == domain 1 score: 10.9 bits; conditional E-value: 1.9e-05 Gcd10p 165 dvslll..eyllekkdaqkilelreetlglllslanvhaggryLvvDdtgGLl 215 d+++ll +++l+++ +q++ +lr++ l+l + v ++gr L ++t+ ++ tr|A0A0R4IR49|A0A0R4IR49_DANRE 500 DIQQLLdgKFYLADQLVQRVSKLRDDLLSLRSECSSVYSKGRTLTSEQTKMMI 552 55555422699999*********************************998655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (300 nodes) Target sequences: 25687 (13798380 residues searched) Passed MSV filter: 1796 (0.0699186); expected 513.7 (0.02) Passed bias filter: 541 (0.0210612); expected 513.7 (0.02) Passed Vit filter: 50 (0.00194651); expected 25.7 (0.001) Passed Fwd filter: 2 (7.78604e-05); expected 0.3 (1e-05) Initial search space (Z): 25687 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.32u 0.01s 00:00:00.33 Elapsed: 00:00:00.11 # Mc/sec: 37631.95 // [ok]