# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  pfam_list/Gcd10p.hmm.txt
# target sequence database:        proteomes/Monodelphis_domestica.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       Gcd10p  [M=300]
Accession:   PF04189.12
Description: Gcd10p family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
    2.9e-70  237.0   4.7    1.1e-69  235.1   4.7    1.9  1  tr|F7AA51|F7AA51_MONDO  tRNA (adenine(58)-N(1))-methyltransfe


Domain annotation for each sequence (and alignments):
>> tr|F7AA51|F7AA51_MONDO  tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Monodelphis domestica
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  235.1   4.7   5.2e-74   1.1e-69       2     264 ..      21     253 ..      20     367 .. 0.92

  Alignments for each domain:
  == domain 1  score: 235.1 bits;  conditional E-value: 5.2e-74
                  Gcd10p   2 IkpnqhvllkLpsenlkivqvkpnttisLgKfgsfplnliigrpygltfeildkreeeeksrlrvvpaaeleaeslaeeeaeeeeee 88 
                             I+ +++v+lk  ++++k vqv++ ++++++K++ f l+++ig+ yg+tfe+ ++ + + k+            e++++e++e     
  tr|F7AA51|F7AA51_MONDO  21 IRDGDFVVLK-REDVFKAVQVQRRKKVTFEKQW-FFLDNVIGHSYGTTFEVSNSGNLQPKK----------MMEEITSETKE----- 90 
                             899*******.777*******************.*******************99665443..........34444444433..... PP

                  Gcd10p  89 eeardnreiiddgarQkLtkeeIeeLKkegasagkeiIaklleshtafdqKTaFSqeKYlkrKkkKYlkrftvlpldvsllleylle 175
                              ++ dnr+i+ddg++QkLt+++I++LK++g++ g+ei+++l+e++t+f++KT+F+q+KY+k+KkkKY   +tv +++++ l  ++++
  tr|F7AA51|F7AA51_MONDO  91 -AGIDNRNIVDDGKSQKLTQDDIKALKDKGIK-GEEIVQQLIENSTTFRDKTEFAQDKYIKKKKKKYEAIITVVKPSTRILSIMYYA 175
                             .389****************************.****************************************************** PP

                  Gcd10p 176 kkdaqkilelreetlglllslanvhaggryLvvDdtgGLlvaalaeRmgifessakegtitliheneqpnlsllkyfnydaaepehp 262
                              ++++ki  +r +tl+++l+l+n+hag++++v+++++GL+++a++eRmg+       g+i++++++  p  ++  +f++    p+++
  tr|F7AA51|F7AA51_MONDO 176 -REPGKINYMRYDTLAQMLTLGNIHAGNKMVVMETCAGLVLGAVMERMGG------FGSIIQMYPGGGPVRAATTCFGF----PKSF 251
                             .9************************************************......9*************999999999....6666 PP

                  Gcd10p 263 lk 264
                              +
  tr|F7AA51|F7AA51_MONDO 252 FN 253
                             55 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                              1  (300 nodes)
Target sequences:                        21272  (11266248 residues searched)
Passed MSV filter:                      1531  (0.0719725); expected 425.4 (0.02)
Passed bias filter:                      461  (0.0216717); expected 425.4 (0.02)
Passed Vit filter:                        32  (0.00150432); expected 21.3 (0.001)
Passed Fwd filter:                         1  (4.70102e-05); expected 0.2 (1e-05)
Initial search space (Z):              21272  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.27u 0.01s 00:00:00.28 Elapsed: 00:00:00.09
# Mc/sec: 37554.16
//
[ok]