# hmmsearch :: search profile(s) against a sequence database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: pfam_list/Gcd10p.hmm.txt # target sequence database: proteomes/Nematostella_vectensis.fasta # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: Gcd10p [M=300] Accession: PF04189.12 Description: Gcd10p family Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-61 206.1 0.3 1.2e-57 195.8 0.3 2.2 1 tr|A7SIP3|A7SIP3_NEMVE Predicted protein (Fragment) OS=Nemat ------ inclusion threshold ------ 0.073 12.6 0.1 0.13 11.8 0.0 1.4 2 tr|A7RHG9|A7RHG9_NEMVE tRNA (adenine(58)-N(1))-methyltransfe Domain annotation for each sequence (and alignments): >> tr|A7SIP3|A7SIP3_NEMVE Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g119805 PE=4 SV=1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 195.8 0.3 9.5e-62 1.2e-57 2 288 .. 16 268 .. 15 280 .. 0.85 Alignments for each domain: == domain 1 score: 195.8 bits; conditional E-value: 9.5e-62 Gcd10p 2 IkpnqhvllkLpse.nlkivqvkpnttisLgKfgsfplnliigrpygltfeildkreeeeksrlrvvpaaeleaeslaeeeaeeeee 87 I+++++v+lk s+ nl+ivqv ++ +i +++ f l+++ig +yg+tfe+ +++ +r+ + tr|A7SIP3|A7SIP3_NEMVE 16 ITEGKYVILK--SGnNLRIVQVLKDRKIAFERLH-FFLDDAIGCHYGTTFEVDRDK-------VRPC---------WD--------- 74 99********..776*******************.****************99888.......5555.........22......... PP Gcd10p 88 eeeardnreiiddgarQkLtkeeIeeLKkegasagkeiIaklleshtafdqKTaFSqeKYlkrKkkKYlk...rftvlpldvsllle 171 +++ + i dg +QkL+ke+I++LK +g s gk+i+++l++++++ +++T+FS++KY krK kKY++ rft++++++ ll+e tr|A7SIP3|A7SIP3_NEMVE 75 ---TESSQPIKCDGDSQKLSKEDIQSLKAQGLS-GKDIVDQLVQNSETYKDRTEFSKAKYRKRKSKKYVQhiiRFTIHKPNTCLLAE 157 ...3456778889********************.**********************************876668************* PP Gcd10p 172 yllekkdaqkilelreetlglllslanvhaggryLvvDdtgGLlvaalaeRmgifessakegtitliheneqpnlsllkyfnydaae 258 ++++ k +qki++lr ++l+++l+lan++a++r+Lv+++++G++v+++++Rmg+ g+i++ h+++ p +++y+n+ tr|A7SIP3|A7SIP3_NEMVE 158 TYYS-KMPQKICDLRPDALSQILTLANIRANSRVLVMEQCQGMIVGSILDRMGG------YGSIVQAHNGDFPTRIAMDYYNF---- 233 ****.9************************************************......***********************.... PP Gcd10p 259 pehplkkh..lktlswlqlle...peedetyeeep 288 ++++l+ + +++ +l+e p+e+ + ++e tr|A7SIP3|A7SIP3_NEMVE 234 SSEFLSIVhgFPLIKLNTLTEktaPDEEIKGKNED 268 77777743332233333333332233333333333 PP >> tr|A7RHG9|A7RHG9_NEMVE tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A OS=Nematostella vectensis # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 11.8 0.0 1.1e-05 0.13 1 48 [. 9 55 .. 9 60 .. 0.93 2 ? -3.7 0.0 0.57 7e+03 49 66 .. 130 145 .. 122 170 .. 0.57 Alignments for each domain: == domain 1 score: 11.8 bits; conditional E-value: 1.1e-05 Gcd10p 1 lIkpnqhvllkLpsenlkivqvkpnttisLgKfgsfplnliigrpygl 48 +I ++++v+l L ++n+ + v+ ++ ++ Kfg+fp ++++g+++g+ tr|A7RHG9|A7RHG9_NEMVE 9 TICEGDTVILYLGHNNMHSIVVTAGK-VHQTKFGAFPHSDMVGKQFGS 55 6999****************998876.999****************97 PP == domain 2 score: -3.7 bits; conditional E-value: 0.57 Gcd10p 49 tfeildkreeeeksrlrv 66 t+e +++r++++++ + tr|A7RHG9|A7RHG9_NEMVE 130 TYEFHEERSKQARK--EF 145 66666666555444..22 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (300 nodes) Target sequences: 24428 (8257945 residues searched) Passed MSV filter: 1183 (0.048428); expected 488.6 (0.02) Passed bias filter: 426 (0.017439); expected 488.6 (0.02) Passed Vit filter: 33 (0.00135091); expected 24.4 (0.001) Passed Fwd filter: 2 (8.18733e-05); expected 0.2 (1e-05) Initial search space (Z): 24428 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.19u 0.01s 00:00:00.20 Elapsed: 00:00:00.07 # Mc/sec: 35391.19 // [ok]