# hmmsearch :: search profile(s) against a sequence database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: pfam_list/Gcd10p.hmm.txt # target sequence database: proteomes/Ornithorhynchus_anatinus.fasta # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: Gcd10p [M=300] Accession: PF04189.12 Description: Gcd10p family Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-65 221.7 0.1 1.3e-65 221.7 0.1 1.6 2 tr|F6WQ55|F6WQ55_ORNAN tRNA (adenine(58)-N(1))-methyltransfe 2.2e-17 63.4 0.0 3e-17 63.0 0.0 1.3 1 tr|F6SN38|F6SN38_ORNAN Uncharacterized protein OS=Ornithorhy Domain annotation for each sequence (and alignments): >> tr|F6WQ55|F6WQ55_ORNAN tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Ornithorhynchus anati # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 221.7 0.1 1.2e-69 1.3e-65 27 265 .. 2 211 .. 1 268 [. 0.89 2 ? -2.6 1.0 0.25 2.7e+03 94 94 .. 297 297 .. 227 330 .. 0.54 Alignments for each domain: == domain 1 score: 221.7 bits; conditional E-value: 1.2e-69 Gcd10p 27 tisLgKfgsfplnliigrpygltfeildkreeeeksrlrvvpaaeleaeslaeeeaeeeeeeeeardnreiiddgarQkLtkeeIee 113 ++ ++K++ f+l+++ig++yg+tfe+ + + + k+ + e++++e++e +++dnr+iiddg++QkLt+++I++ tr|F6WQ55|F6WQ55_ORNAN 2 KVIFEKQW-FYLDNVIGQNYGTTFEVSSGGSLQPKK----------KVEETSTETKE------AGTDNRNIIDDGKSQKLTQDDIKA 71 68899***.********************9654443..........22333333322......389********************* PP Gcd10p 114 LKkegasagkeiIaklleshtafdqKTaFSqeKYlkrKkkKYlkrftvlpldvsllleyllekkdaqkilelreetlglllslanvh 200 LK++g++ g+ei+++l+e++t+f++KT+F+q+KY+k+KkkKY +t+ +++++ l ++++ ++++ki +lr +tl+++l+l+n++ tr|F6WQ55|F6WQ55_ORNAN 72 LKDKGIK-GEEIVQQLIENSTTFRDKTEFAQDKYIKKKKKKYEAIITIVKPSTRILSVMYYA-REPGKINHLRYDTLAQMLTLGNIR 156 *******.******************************************************.9*********************** PP Gcd10p 201 aggryLvvDdtgGLlvaalaeRmgifessakegtitliheneqpnlsllkyfnydaaepehplkk 265 ag++++vv++++GL+++a++eRmg+ g+i++++++ p ++ +f++ pe++ ++ tr|F6WQ55|F6WQ55_ORNAN 157 AGNKMIVVETCAGLVLGAVMERMGG------FGSIIQMYPGGGPVRAATACFGF----PESFFNS 211 *************************......***********************....7777665 PP == domain 2 score: -2.6 bits; conditional E-value: 0.25 Gcd10p 94 n 94 tr|F6WQ55|F6WQ55_ORNAN 297 V 297 1 PP >> tr|F6SN38|F6SN38_ORNAN Uncharacterized protein OS=Ornithorhynchus anatinus OX=9258 PE=4 SV=1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.0 0.0 2.7e-21 3e-17 185 266 .. 1 72 [. 1 133 [. 0.84 Alignments for each domain: == domain 1 score: 63.0 bits; conditional E-value: 2.7e-21 Gcd10p 185 lreetlglllslanvhaggryLvvDdtgGLlvaalaeRmgifessakegtitliheneqpnlsllkyfnydaaepehplkkh 266 lr +tl+++l+l+n++ag++++vv++++GL+++a++eRmg+ g+i++++++ p ++ +f++ pe++ ++ tr|F6SN38|F6SN38_ORNAN 1 LRYDTLAQMLTLGNIRAGNKMIVVETCAGLVLGAVMERMGG------FGSIIQMYPGGGPVRAATACFGF----PESFFNSL 72 89***************************************......***********************....77777654 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (300 nodes) Target sequences: 21677 (8259262 residues searched) Passed MSV filter: 1083 (0.0499608); expected 433.5 (0.02) Passed bias filter: 442 (0.0203903); expected 433.5 (0.02) Passed Vit filter: 39 (0.00179914); expected 21.7 (0.001) Passed Fwd filter: 2 (9.22637e-05); expected 0.2 (1e-05) Initial search space (Z): 21677 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.22u 0.01s 00:00:00.23 Elapsed: 00:00:00.07 # Mc/sec: 35396.84 // [ok]