# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  pfam_list/Gcd10p.hmm.txt
# target sequence database:        proteomes/Petromyzon_marinus.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       Gcd10p  [M=300]
Accession:   PF04189.12
Description: Gcd10p family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
    1.9e-40  138.4   0.2    2.3e-40  138.2   0.2    1.1  1  tr|S4RXB8|S4RXB8_PETMA  Uncharacterized protein OS=Petromyzon


Domain annotation for each sequence (and alignments):
>> tr|S4RXB8|S4RXB8_PETMA  Uncharacterized protein OS=Petromyzon marinus OX=7757 PE=4 SV=1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  138.2   0.2   1.7e-44   2.3e-40      25     186 ..      35     179 .]      19     179 .] 0.91

  Alignments for each domain:
  == domain 1  score: 138.2 bits;  conditional E-value: 1.7e-44
                  Gcd10p  25 nttisLgKfgsfplnliigrpygltfeildkreeeeksrlrvvpaaeleaeslaeeeaeeeeeeeeardnreiiddgarQkLtkeeI 111
                             + +++++K++ f ++++ig +yg+tf+i    + +        p++ l+ae+  +e+         + dnr+i  dg++QkLt+++I
  tr|S4RXB8|S4RXB8_PETMA  35 KWKVNFEKKW-FFVDSLIGARYGTTFDITGGGDLQPL-----CPSNALKAEVAVAES---------GVDNRNIQSDGSAQKLTRDDI 106
                             5689******.********************976554.....477777777776665.........789****************** PP

                  Gcd10p 112 eeLKkegasagkeiIaklleshtafdqKTaFSqeKYlkrKkkKYlkrftvlpldvsllleyllekkdaqkilelr 186
                              +LK++g   g ei+++l+e++++f++KT+FSqeKY+krKkkKY + +tvl+++++ll++++++ ++++ki++lr
  tr|S4RXB8|S4RXB8_PETMA 107 SALKEQGLR-GTEIVSQLVENSSTFKEKTEFSQEKYIKRKKKKYESHITVLKPNARLLATMYHS-REPAKICHLR 179
                             *********.******************************************************.9*******98 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                              1  (300 nodes)
Target sequences:                        13539  (5048892 residues searched)
Passed MSV filter:                       514  (0.0379644); expected 270.8 (0.02)
Passed bias filter:                      229  (0.0169141); expected 270.8 (0.02)
Passed Vit filter:                        24  (0.00177266); expected 13.5 (0.001)
Passed Fwd filter:                         1  (7.38607e-05); expected 0.1 (1e-05)
Initial search space (Z):              13539  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.12u 0.00s 00:00:00.12 Elapsed: 00:00:00.05
# Mc/sec: 30293.35
//
[ok]