# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file: pfam_list/Gcd10p.hmm.txt
# target sequence database: proteomes/Trichomonas_vaginalis.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query: Gcd10p [M=300]
Accession: PF04189.12
Description: Gcd10p family
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
------ inclusion threshold ------
0.053 14.1 0.0 0.062 13.9 0.0 1.1 1 tr|A2FHG4|A2FHG4_TRIVA Uncharacterized protein OS=Trichomona
1.5 9.4 3.0 2.3 8.7 1.4 2.0 2 tr|A2GJV9|A2GJV9_TRIVA Uncharacterized protein OS=Trichomona
Domain annotation for each sequence (and alignments):
>> tr|A2FHG4|A2FHG4_TRIVA Uncharacterized protein OS=Trichomonas vaginalis OX=5722 GN=TVAG_045280 PE=4 SV=1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? 13.9 0.0 2.5e-06 0.062 225 295 .. 32 145 .. 8 149 .. 0.78
Alignments for each domain:
== domain 1 score: 13.9 bits; conditional E-value: 2.5e-06
Gcd10p 225 i..........................................f.essakegtitliheneqpnlsllkyfnydaaepehplkkhlk 268
+ ++ +k+ tit h+ + + s+l+ +++ + e + +lk
tr|A2FHG4|A2FHG4_TRIVA 32 CqdpiicfhnniilekhfsfdfydvkdgdhiyttsengrsnlkLcQKLSKSITITNQHDRFSLENSCLRLIDMTFVRAEGSYSANLK 118
4666666666666666666666666666666666666666666448899999*********************9999999999**** PP
Gcd10p 269 tlswlqllepeedetyeeepeevseee 295
++w + l+++e++ y+++p+ ++e++
tr|A2FHG4|A2FHG4_TRIVA 119 LVNWYNNLQKTETTFYQTTPTILPEKS 145
*******************99887765 PP
>> tr|A2GJV9|A2GJV9_TRIVA Uncharacterized protein OS=Trichomonas vaginalis OX=5722 GN=TVAG_382340 PE=4 SV=1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -0.3 0.0 0.051 1.3e+03 220 289 .. 11 89 .. 6 99 .. 0.62
2 ? 8.7 1.4 9.4e-05 2.3 134 163 .. 98 127 .. 94 160 .. 0.83
Alignments for each domain:
== domain 1 score: -0.3 bits; conditional E-value: 0.051
Gcd10p 220 aeRmgi.......fessakegtitliheneqpnlsllkyfnydaae....pehplkkhlktlswlqllepeedetyeeepe 289
+e+m ++e+++ ++ ++++p ++l y++ ++++ + l + l ++ lle++e++t++ +pe
tr|A2GJV9|A2GJV9_TRIVA 11 MEKMTEasrefvdCYYDSNENKLNVLRKGTSPIITLPSYSSIEKNAlnykYDMSLGDVLDFIT--ALLETTETDTTSRKPE 89
666666555544224457889999999999999999999999776664433334444444444..4556555555555554 PP
== domain 2 score: 8.7 bits; conditional E-value: 9.4e-05
Gcd10p 134 tafdqKTaFSqeKYlkrKkkKYlkrftvlp 163
+f qK S++K+l + +kKY++r++v +
tr|A2GJV9|A2GJV9_TRIVA 98 RTFTQKVIPSKAKFLDLWEKKYISRMHVYY 127
5899**********************9976 PP
Internal pipeline statistics summary:
-------------------------------------
Query model(s): 1 (300 nodes)
Target sequences: 50190 (17055200 residues searched)
Passed MSV filter: 5607 (0.111715); expected 1003.8 (0.02)
Passed bias filter: 1658 (0.0330345); expected 1003.8 (0.02)
Passed Vit filter: 114 (0.00227137); expected 50.2 (0.001)
Passed Fwd filter: 2 (3.98486e-05); expected 0.5 (1e-05)
Initial search space (Z): 50190 [actual number of targets]
Domain search space (domZ): 2 [number of targets reported over threshold]
# CPU time: 0.49u 0.01s 00:00:00.50 Elapsed: 00:00:00.15
# Mc/sec: 34110.40
//
[ok]