# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  pfam_list/PCIF1_WW.hmm.txt
# target sequence database:        proteomes/Drosophila_melanogaster.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       PCIF1_WW  [M=172]
Accession:   PF12237.8
Description: Phosphorylated CTD interacting factor 1 WW domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
    2.4e-66  222.2   0.9    4.1e-66  221.5   0.9    1.4  1  tr|Q9VPB7|Q9VPB7_DROME  FI17508p1 OS=Drosophila melanogaster 
  ------ inclusion threshold ------
      0.062   12.5   0.0       0.13   11.5   0.0    1.6  1  sp|P22465|ANX10_DROME   Annexin B10 OS=Drosophila melanogaste


Domain annotation for each sequence (and alignments):
>> tr|Q9VPB7|Q9VPB7_DROME  FI17508p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG11399 PE=1 SV=1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  221.5   0.9   5.9e-70   4.1e-66       1     172 []     517     690 ..     517     690 .. 0.98

  Alignments for each domain:
  == domain 1  score: 221.5 bits;  conditional E-value: 5.9e-70
                PCIF1_WW   1 kLkeLyesseeddekleaflsrvfalllrYdallg........eaglqaalpeevfevLkkefgvsfecfAsPlncyfeqycsafpd 79 
                             kL++Ly+++++dd+k++ f  rv++ll+rY+++lg        ++ +qaalp  vfe+L+++fgvsfecfAsP+n+yf+qycsaf+d
  tr|Q9VPB7|Q9VPB7_DROME 517 KLEQLYRHNCFDDKKFDLFIGRVWCLLKRYQTFLGnalnssqeAELTQAALPVPVFECLHRQFGVSFECFASPFNSYFRQYCSAFAD 603
                             8***************************************9988899**************************************** PP

                PCIF1_WW  80 tDayFGsvGsffdfkpasgsfeanPPfveevleraaehieklLeaaeeesepLsfvvvvpewretealkkleesrykrkevvieake 166
                             tDayFGs+G+f+dfkp+sgsf++nPP++ee++e+ + hi+klL+++    epLsf+v++pew++   ++kl++s ykr+++v+  ++
  tr|Q9VPB7|Q9VPB7_DROME 604 TDAYFGSRGPFLDFKPVSGSFQVNPPHCEELIEASLLHIDKLLTDT---MEPLSFIVFLPEWKS---ISKLDDSMYKRRSMVVLGMA 684
                             **********************************************...9************76...699***************** PP

                PCIF1_WW 167 heyreg 172
                             heyr+g
  tr|Q9VPB7|Q9VPB7_DROME 685 HEYRHG 690
                             ****97 PP

>> sp|P22465|ANX10_DROME  Annexin B10 OS=Drosophila melanogaster OX=7227 GN=AnxB10 PE=2 SV=3
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.5   0.0   1.9e-05      0.13      23      66 ..     207     249 ..     178     266 .. 0.84

  Alignments for each domain:
  == domain 1  score: 11.5 bits;  conditional E-value: 1.9e-05
               PCIF1_WW  23 vfalllrYdallgeaglqaalpeevfevLkkefgvsfecfAsPl 66 
                            + ++   Y+ l+g +++++a+++e+ + L++++   +ec  sP 
  sp|P22465|ANX10_DROME 207 LRLVFEEYKVLSG-QTIEQAIKHEMSDELHEAMMAIVECVQSPA 249
                            4566778******.99***************************5 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                              1  (172 nodes)
Target sequences:                        13786  (7394964 residues searched)
Passed MSV filter:                       382  (0.0277093); expected 275.7 (0.02)
Passed bias filter:                      265  (0.0192224); expected 275.7 (0.02)
Passed Vit filter:                        18  (0.00130567); expected 13.8 (0.001)
Passed Fwd filter:                         2  (0.000145075); expected 0.1 (1e-05)
Initial search space (Z):              13786  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.10u 0.00s 00:00:00.10 Elapsed: 00:00:00.04
# Mc/sec: 31798.35
//
[ok]