# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file: pfam_list/PCIF1_WW.hmm.txt
# target sequence database: proteomes/Macaca_mulatta.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query: PCIF1_WW [M=172]
Accession: PF12237.8
Description: Phosphorylated CTD interacting factor 1 WW domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.9e-70 234.8 0.1 7.2e-70 234.3 0.1 1.3 1 tr|H9FYB1|H9FYB1_MACMU PDX1 C-terminal inhibiting factor 1 O
------ inclusion threshold ------
0.013 15.3 0.0 0.029 14.2 0.0 1.5 1 tr|F7GL08|F7GL08_MACMU Sorting nexin OS=Macaca mulatta OX=95
Domain annotation for each sequence (and alignments):
>> tr|H9FYB1|H9FYB1_MACMU PDX1 C-terminal inhibiting factor 1 OS=Macaca mulatta OX=9544 GN=PCIF1 PE=2 SV=1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 234.3 0.1 6.8e-74 7.2e-70 1 172 [] 446 621 .. 446 621 .. 0.99
Alignments for each domain:
== domain 1 score: 234.3 bits; conditional E-value: 6.8e-74
PCIF1_WW 1 kLkeLyesseeddekleaflsrvfalllrYdallg.....eaglqaalpeevfevLkkefgvsfecfAsPlncyfeqycsafpdtDa 82
kL Ly++s+ dd+ +e fl rv++ll+rY++++g ++glq++lp +vfe+L++ fgvsfecfAsPlncyf+qycsafpdtD+
tr|H9FYB1|H9FYB1_MACMU 446 KLWLLYRYSCIDDSAFERFLPRVWCLLRRYQMMFGvglyeGTGLQGSLPVHVFEALHRLFGVSFECFASPLNCYFRQYCSAFPDTDG 532
7899***********************************99********************************************** PP
PCIF1_WW 83 yFGsvGsffdfkpasgsfeanPPfveevleraaehieklLeaaeeesepLsfvvvvpewre..tealkkleesrykrkevvieakeh 167
yFGs+G+++df+p sgsfeanPPf+ee+++++++h+eklLe++ epLsf+v++pewre t al+++e+sr+kr++++++a eh
tr|H9FYB1|H9FYB1_MACMU 533 YFGSRGPCLDFAPLSGSFEANPPFCEELMDAMVSHFEKLLESS---PEPLSFIVFIPEWREppTPALTRMEQSRFKRHQLILPAFEH 616
*******************************************...***************999*********************** PP
PCIF1_WW 168 eyreg 172
eyr+g
tr|H9FYB1|H9FYB1_MACMU 617 EYRSG 621
**986 PP
>> tr|F7GL08|F7GL08_MACMU Sorting nexin OS=Macaca mulatta OX=9544 GN=SNX33 PE=2 SV=1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? 14.2 0.0 2.7e-06 0.029 92 123 .. 420 451 .. 408 460 .. 0.85
Alignments for each domain:
== domain 1 score: 14.2 bits; conditional E-value: 2.7e-06
PCIF1_WW 92 dfkpasgsfeanPPfveevleraaehieklLe 123
+f+++s sf++ PPf++e l++a++h ++ e
tr|F7GL08|F7GL08_MACMU 420 AFQAISHSFQMDPPFCSEALNSAISHTGRTYE 451
58899*******************99877655 PP
Internal pipeline statistics summary:
-------------------------------------
Query model(s): 1 (172 nodes)
Target sequences: 21211 (10888574 residues searched)
Passed MSV filter: 528 (0.0248927); expected 424.2 (0.02)
Passed bias filter: 396 (0.0186696); expected 424.2 (0.02)
Passed Vit filter: 28 (0.00132007); expected 21.2 (0.001)
Passed Fwd filter: 2 (9.42907e-05); expected 0.2 (1e-05)
Initial search space (Z): 21211 [actual number of targets]
Domain search space (domZ): 2 [number of targets reported over threshold]
# CPU time: 0.14u 0.01s 00:00:00.15 Elapsed: 00:00:00.07
# Mc/sec: 26754.78
//
[ok]