# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  pfam_list/PCIF1_WW.hmm.txt
# target sequence database:        proteomes/Macaca_mulatta.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       PCIF1_WW  [M=172]
Accession:   PF12237.8
Description: Phosphorylated CTD interacting factor 1 WW domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
    4.9e-70  234.8   0.1    7.2e-70  234.3   0.1    1.3  1  tr|H9FYB1|H9FYB1_MACMU  PDX1 C-terminal inhibiting factor 1 O
  ------ inclusion threshold ------
      0.013   15.3   0.0      0.029   14.2   0.0    1.5  1  tr|F7GL08|F7GL08_MACMU  Sorting nexin OS=Macaca mulatta OX=95


Domain annotation for each sequence (and alignments):
>> tr|H9FYB1|H9FYB1_MACMU  PDX1 C-terminal inhibiting factor 1 OS=Macaca mulatta OX=9544 GN=PCIF1 PE=2 SV=1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  234.3   0.1   6.8e-74   7.2e-70       1     172 []     446     621 ..     446     621 .. 0.99

  Alignments for each domain:
  == domain 1  score: 234.3 bits;  conditional E-value: 6.8e-74
                PCIF1_WW   1 kLkeLyesseeddekleaflsrvfalllrYdallg.....eaglqaalpeevfevLkkefgvsfecfAsPlncyfeqycsafpdtDa 82 
                             kL  Ly++s+ dd+ +e fl rv++ll+rY++++g     ++glq++lp +vfe+L++ fgvsfecfAsPlncyf+qycsafpdtD+
  tr|H9FYB1|H9FYB1_MACMU 446 KLWLLYRYSCIDDSAFERFLPRVWCLLRRYQMMFGvglyeGTGLQGSLPVHVFEALHRLFGVSFECFASPLNCYFRQYCSAFPDTDG 532
                             7899***********************************99********************************************** PP

                PCIF1_WW  83 yFGsvGsffdfkpasgsfeanPPfveevleraaehieklLeaaeeesepLsfvvvvpewre..tealkkleesrykrkevvieakeh 167
                             yFGs+G+++df+p sgsfeanPPf+ee+++++++h+eklLe++    epLsf+v++pewre  t al+++e+sr+kr++++++a eh
  tr|H9FYB1|H9FYB1_MACMU 533 YFGSRGPCLDFAPLSGSFEANPPFCEELMDAMVSHFEKLLESS---PEPLSFIVFIPEWREppTPALTRMEQSRFKRHQLILPAFEH 616
                             *******************************************...***************999*********************** PP

                PCIF1_WW 168 eyreg 172
                             eyr+g
  tr|H9FYB1|H9FYB1_MACMU 617 EYRSG 621
                             **986 PP

>> tr|F7GL08|F7GL08_MACMU  Sorting nexin OS=Macaca mulatta OX=9544 GN=SNX33 PE=2 SV=1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.2   0.0   2.7e-06     0.029      92     123 ..     420     451 ..     408     460 .. 0.85

  Alignments for each domain:
  == domain 1  score: 14.2 bits;  conditional E-value: 2.7e-06
                PCIF1_WW  92 dfkpasgsfeanPPfveevleraaehieklLe 123
                             +f+++s sf++ PPf++e l++a++h  ++ e
  tr|F7GL08|F7GL08_MACMU 420 AFQAISHSFQMDPPFCSEALNSAISHTGRTYE 451
                             58899*******************99877655 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                              1  (172 nodes)
Target sequences:                        21211  (10888574 residues searched)
Passed MSV filter:                       528  (0.0248927); expected 424.2 (0.02)
Passed bias filter:                      396  (0.0186696); expected 424.2 (0.02)
Passed Vit filter:                        28  (0.00132007); expected 21.2 (0.001)
Passed Fwd filter:                         2  (9.42907e-05); expected 0.2 (1e-05)
Initial search space (Z):              21211  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.14u 0.01s 00:00:00.15 Elapsed: 00:00:00.07
# Mc/sec: 26754.78
//
[ok]