# hmmsearch :: search profile(s) against a sequence database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: pfam_list/PCIF1_WW.hmm.txt # target sequence database: proteomes/Monosiga_brevicollis.fasta # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: PCIF1_WW [M=172] Accession: PF12237.8 Description: Phosphorylated CTD interacting factor 1 WW domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-52 174.8 0.8 9.9e-52 174.1 0.8 1.4 1 tr|A9UVB7|A9UVB7_MONBE Predicted protein OS=Monosiga brevico 1.1e-29 102.3 0.1 2.6e-29 101.1 0.0 1.6 2 tr|A9V8J3|A9V8J3_MONBE Predicted protein OS=Monosiga brevico Domain annotation for each sequence (and alignments): >> tr|A9UVB7|A9UVB7_MONBE Predicted protein OS=Monosiga brevicollis OX=81824 GN=6793 PE=4 SV=1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 174.1 0.8 2.1e-55 9.9e-52 1 171 [. 413 585 .. 413 586 .. 0.95 Alignments for each domain: == domain 1 score: 174.1 bits; conditional E-value: 2.1e-55 PCIF1_WW 1 kLkeLye.sseeddekleaflsrvfalllrYdallg..eaglqaalpeevfevLkkefgvsfecfAsPlncyfeqycsafpdtDayF 84 +L++Ly+ ++e++d+++++f++ ++++ lrY+++l ++++p+++ ++L+k+++++f++fAsP+n+y+++++sa pd+D++F tr|A9UVB7|A9UVB7_MONBE 413 RLAKLYRtHCEAFDPERQHFHRLALCVGLRYQTILFepYVDGENSMPAAFKAFLTKQLHCCFDSFASPFNAYYRNFASAAPDLDSFF 499 689****888999*********************9855567789******************************************* PP PCIF1_WW 85 GsvGsffdfkpasgsfeanPPfveevleraaehieklLeaaeeesepLsfvvvvpewre..tealkkleesrykrkevvieakehey 169 GsvGsffdf+p++gsf a+PPfve vl+r+a++ie+lL+a+ s+pLsfvv++pewr +al+ l++s+++r++++ie +++++ tr|A9UVB7|A9UVB7_MONBE 500 GSVGSFFDFTPSQGSFVAFPPFVELVLDRTADRIEALLNAS---SDPLSFVVMMPEWRLykLHALDVLDQSPHRRADFLIEGNKQAI 583 *****************************************...9*************98899*******************99987 PP PCIF1_WW 170 re 171 ++ tr|A9UVB7|A9UVB7_MONBE 584 LS 585 66 PP >> tr|A9V8J3|A9V8J3_MONBE Predicted protein OS=Monosiga brevicollis OX=81824 GN=28562 PE=4 SV=1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.1 0.0 0.59 2.7e+03 59 73 .. 96 111 .. 90 133 .. 0.71 2 ! 101.1 0.0 5.7e-33 2.6e-29 17 169 .. 306 467 .. 298 469 .. 0.91 Alignments for each domain: == domain 1 score: -3.1 bits; conditional E-value: 0.59 PCIF1_WW 59 fec.fAsPlncyfeqy 73 ec A P+n feq tr|A9V8J3|A9V8J3_MONBE 96 KECdTARPFNYAFEQL 111 5664689999999864 PP == domain 2 score: 101.1 bits; conditional E-value: 5.7e-33 PCIF1_WW 17 eaflsrvfalllrYdallgeaglqaalpeevfevLkkefgvsfecfAsPlncyfe.......qycsafpdtDayFGsvGsffdf..k 94 + l++v ++rY a l ++++++ p+e++++L +++g e+fA Pln++ ++cs ++dtDa+FGs+Gsff+ tr|A9V8J3|A9V8J3_MONBE 306 QWQLAQVARCIFRYAAHLHTTAQHWGHPQEFYNFLARRLGLLREAFACPLNSRVLgyndpaaRFCSLYRDTDAPFGSLGSFFETdmL 392 55567888899*****9999*******************************99777889999********************66215 PP PCIF1_WW 95 pasgsfeanPPfveevleraaehieklLeaaeeesepLsfvvvvpewretealkkleesrykrkevvieakehey 169 ++ + ++PPf+e++l+r +++++ L++a++++++L + p+w+++ +++l++s++kr+ev+ +++++y tr|A9V8J3|A9V8J3_MONBE 393 ASGYGWVVHPPFTEDILNRLSAQCQSALQQAASQDRQLIVGIGWPNWTDMPSYHQLRDSPFKRSEVLQVKYNYHY 467 5556799***********************************************************999998888 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (172 nodes) Target sequences: 9188 (5511963 residues searched) Passed MSV filter: 199 (0.0216587); expected 183.8 (0.02) Passed bias filter: 167 (0.0181759); expected 183.8 (0.02) Passed Vit filter: 17 (0.00185024); expected 9.2 (0.001) Passed Fwd filter: 2 (0.000217675); expected 0.1 (1e-05) Initial search space (Z): 9188 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.07u 0.00s 00:00:00.07 Elapsed: 00:00:00.04 # Mc/sec: 23701.44 // [ok]