# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file: pfam_list/PCIF1_WW.hmm.txt
# target sequence database: proteomes/Tetrahymena_thermophila.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query: PCIF1_WW [M=172]
Accession: PF12237.8
Description: Phosphorylated CTD interacting factor 1 WW domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.4e-45 154.0 2.3 4.4e-45 154.0 2.3 2.1 2 tr|Q23AF0|Q23AF0_TETTS Phosphorylated CTD-interacting factor
------ inclusion threshold ------
0.11 12.7 0.1 0.22 11.7 0.1 1.5 1 tr|Q23IA0|Q23IA0_TETTS Heat shock 70 kDa protein OS=Tetrahym
Domain annotation for each sequence (and alignments):
>> tr|Q23AF0|Q23AF0_TETTS Phosphorylated CTD-interacting factor 1 OS=Tetrahymena thermophila (strain SB210) OX=312017 G
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? 0.9 0.1 0.035 4.7e+02 6 53 .. 134 182 .. 130 188 .. 0.67
2 ! 154.0 2.3 3.2e-49 4.4e-45 9 171 .. 198 359 .. 191 360 .. 0.97
Alignments for each domain:
== domain 1 score: 0.9 bits; conditional E-value: 0.035
PCIF1_WW 6 yesseeddekleaflsrvfalllrYdallg.eaglqaalpeevfevLkk 53
y+++ +++++++ s +l rY++++ + +++++ +eev ++L++
tr|Q23AF0|Q23AF0_TETTS 134 YKQKLSNADEYSFNISDYNMLQQRYQNFQTiQDEQDQSDQEEVNQLLSQ 182
554444444444444455566689*999987777888888888888876 PP
== domain 2 score: 154.0 bits; conditional E-value: 3.2e-49
PCIF1_WW 9 seeddekleaflsrvfalllrYdallgeaglqaalpeevfevLkkefgvsfecfAsPlncyfeqycsafpdtDayFGsvGsff.dfk 94
++ ++k++++++++f++l++Yd + ++g+q++l++evf++Lk+ +++++e+fAsP+n ++e+y+s f + D+yFGs+G+f ++
tr|Q23AF0|Q23AF0_TETTS 198 GNNIAHKDTIMNQKIFLTLFWYDYIGIQNGQQWSLNSEVFDLLKQFLNINTEVFASPFNRNLENYFSLF-ESDKYFGSFGNFNkNYL 283
56788999*************************************************************.99***********999* PP
PCIF1_WW 95 pasgsfeanPPfveevleraaehieklLeaaeeesepLsfvvvvpewretealkkleesrykrkevvieakeheyre 171
+++++f+anPPf++++++++a++i ++Le ++++++++ +v+v+p w++++ + +l++s+y+ +e+ + +++h+y++
tr|Q23AF0|Q23AF0_TETTS 284 NIQQNFQANPPFIDNLFTHFAAQILQILEINTQNNREIGCVIVFP-WQDNQGYYQLQNSDYFIDEIELLKNAHYYTD 359
*********************************************.*****************************97 PP
>> tr|Q23IA0|Q23IA0_TETTS Heat shock 70 kDa protein OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_01251
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? 11.7 0.1 1.6e-05 0.22 106 162 .. 357 413 .. 352 420 .. 0.90
Alignments for each domain:
== domain 1 score: 11.7 bits; conditional E-value: 1.6e-05
PCIF1_WW 106 fveevleraaehieklLeaaeeesepLsfvvvvpewretealkkleesrykrkevvi 162
f + ++e++ +++e+l++++e + e++ f+++v + e+ +lk+ + +++ ++v +
tr|Q23IA0|Q23IA0_TETTS 357 FFQTLFENIKNKVEQLIKQTEAKGEKVNFIFMVGGFSESPFLKQEIKNKFETDKVQV 413
788999************************************999999999887654 PP
Internal pipeline statistics summary:
-------------------------------------
Query model(s): 1 (172 nodes)
Target sequences: 26971 (16912921 residues searched)
Passed MSV filter: 1420 (0.0526491); expected 539.4 (0.02)
Passed bias filter: 348 (0.0129027); expected 539.4 (0.02)
Passed Vit filter: 31 (0.00114938); expected 27.0 (0.001)
Passed Fwd filter: 2 (7.41537e-05); expected 0.3 (1e-05)
Initial search space (Z): 26971 [actual number of targets]
Domain search space (domZ): 2 [number of targets reported over threshold]
# CPU time: 0.19u 0.01s 00:00:00.20 Elapsed: 00:00:00.10
# Mc/sec: 29090.22
//
[ok]