# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  pfam_list/PCIF1_WW.hmm.txt
# target sequence database:        proteomes/Trichomonas_vaginalis.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       PCIF1_WW  [M=172]
Accession:   PF12237.8
Description: Phosphorylated CTD interacting factor 1 WW domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
  ------ inclusion threshold ------
       0.17   12.9   0.5        2.7    9.1   0.1    2.3  2  tr|A2D8M3|A2D8M3_TRIVA  Uncharacterized protein OS=Trichomona


Domain annotation for each sequence (and alignments):
>> tr|A2D8M3|A2D8M3_TRIVA  Uncharacterized protein OS=Trichomonas vaginalis OX=5722 GN=TVAG_185790 PE=4 SV=1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.1   0.1   5.3e-05       2.7      93     124 ..      39      70 ..      34      76 .. 0.88
   2 ?    1.6   0.0      0.01   5.2e+02      20      58 ..     239     281 ..     227     286 .. 0.76

  Alignments for each domain:
  == domain 1  score: 9.1 bits;  conditional E-value: 5.3e-05
                PCIF1_WW  93 fkpasgsfeanPPfveevleraaehieklLea 124
                             f+ +  s ea+PPf  e +e+ +eh +++L++
  tr|A2D8M3|A2D8M3_TRIVA  39 FDRSAVSIEAQPPFDPEPFEQYFEHWNEILKR 70 
                             66777899**********************86 PP

  == domain 2  score: 1.6 bits;  conditional E-value: 0.01
                PCIF1_WW  20 lsrvfalllrYdallg....eaglqaalpeevfevLkkefgvs 58 
                             ++ vf +l +Y++ +g    ++++q   ++e f  ++++f+ +
  tr|A2D8M3|A2D8M3_TRIVA 239 ARVVFGVLAKYQMKTGkgltASAWQDKAQAELFIRMRDSFNTQ 281
                             567999*******999667666677777777777777777765 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                              1  (172 nodes)
Target sequences:                        50190  (17055200 residues searched)
Passed MSV filter:                      1392  (0.0277346); expected 1003.8 (0.02)
Passed bias filter:                      811  (0.0161586); expected 1003.8 (0.02)
Passed Vit filter:                        59  (0.00117553); expected 50.2 (0.001)
Passed Fwd filter:                         1  (1.99243e-05); expected 0.5 (1e-05)
Initial search space (Z):              50190  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.24u 0.01s 00:00:00.25 Elapsed: 00:00:00.10
# Mc/sec: 29334.94
//
[ok]