# hmmsearch :: search profile(s) against a sequence database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: pfam_list/Pox_MCEL.hmm.txt # target sequence database: proteomes/Natronomonas_moolapensis.fasta # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: Pox_MCEL [M=333] Accession: PF03291.15 Description: mRNA capping enzyme Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 0.00074 16.0 0.0 0.001 15.6 0.0 1.1 1 tr|M1XL59|M1XL59_NATM8 Probable S-adenosylmethionine-depende Domain annotation for each sequence (and alignments): >> tr|M1XL59|M1XL59_NATM8 Probable S-adenosylmethionine-dependent methyltransferase OS=Natronomonas moolapensis (strain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 15.6 0.0 3.7e-07 0.001 64 110 .. 44 90 .. 31 98 .. 0.87 Alignments for each domain: == domain 1 score: 15.6 bits; conditional E-value: 3.7e-07 Pox_MCEL 64 nklkvLdldcgkGgDLeKyekgeIsklvatDiaeesieeckeRYnkl 110 ++ ++L+l+cg G Le + + ++l ++Di++++ e e Y +l tr|M1XL59|M1XL59_NATM8 44 DDAAILELGCGSGRHLEHLREQGYESLAGIDINDTAFEVMAEAYPRL 90 5678*********************************9999999544 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (333 nodes) Target sequences: 2723 (809592 residues searched) Passed MSV filter: 64 (0.0235035); expected 54.5 (0.02) Passed bias filter: 60 (0.0220345); expected 54.5 (0.02) Passed Vit filter: 7 (0.00257069); expected 2.7 (0.001) Passed Fwd filter: 1 (0.000367242); expected 0.0 (1e-05) Initial search space (Z): 2723 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 26959.41 // [ok]