# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file: pfam_list/TRM13.hmm.txt
# target sequence database: proteomes/Ciona_intestinalis.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query: TRM13 [M=262]
Accession: PF05206.13
Description: Methyltransferase TRM13
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.9e-10 39.6 2.2 2.5e-05 23.8 1.8 2.4 2 tr|F6TIA8|F6TIA8_CIOIN Uncharacterized protein OS=Ciona inte
------ inclusion threshold ------
0.088 12.2 0.1 0.16 11.4 0.1 1.3 1 tr|F7B7G6|F7B7G6_CIOIN Uncharacterized protein OS=Ciona inte
Domain annotation for each sequence (and alignments):
>> tr|F6TIA8|F6TIA8_CIOIN Uncharacterized protein OS=Ciona intestinalis OX=7719 PE=4 SV=2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 23.8 1.8 3e-09 2.5e-05 71 167 .. 364 461 .. 357 474 .. 0.76
2 ! 14.0 0.0 3.1e-06 0.026 214 260 .. 474 520 .. 462 522 .. 0.91
Alignments for each domain:
== domain 1 score: 23.8 bits; conditional E-value: 3e-09
TRM13 71 selaikRlkidIkdLnlsaleele.kkkkv.....vavsKHLCGaATDLtLrcllnsekaskkakleglliAlCChhvCswke...y 148
+e ++R I++Lnl+++ + + +++ ++++ H CG+ATD+ L+ +++++++ ++i CC + + y
tr|F6TIA8|F6TIA8_CIOIN 364 KEESLERAMQRIQELNLKNIMIYQcNLDQFmkkfdIGIALHACGVATDMVLQKCIDQKAS--------FVISPCCYGKIQNTNtlcY 442
34689999999********9987764444466677*****************99998874........89*****865544331225 PP
TRM13 149 vnkeyleelgitkeefqil 167
++e ++++++t+e++ +l
tr|F6TIA8|F6TIA8_CIOIN 443 PQSEKFKSHNVTYEQLVLL 461
5677789999999888776 PP
== domain 2 score: 14.0 bits; conditional E-value: 3.1e-06
TRM13 214 eereeiGlkakrlidegRllalkekgfeaelvkYvekevslEnvlLl 260
+e+++ G+++ l+d+ R+++ k kg+ +++ + + + s+ n l++
tr|F6TIA8|F6TIA8_CIOIN 474 TEKAKQGKQCMGLVDTDRIEYAKTKGYTTSIYTMQPGDCSPKNNLIV 520
68999************************************999886 PP
>> tr|F7B7G6|F7B7G6_CIOIN Uncharacterized protein OS=Ciona intestinalis OX=7719 GN=LOC100184614 PE=4 SV=2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? 11.4 0.1 1.9e-05 0.16 172 250 .. 399 478 .. 395 480 .. 0.89
Alignments for each domain:
== domain 1 score: 11.4 bits; conditional E-value: 1.9e-05
TRM13 172 SWavsgkrkseaeeedekeekekeekkeeeeseeekksklsseereeiGlkakrlidegRllalkek.gfeaelvkYvek 250
S++vs++ + ++ + + +++++++ ++ + + ++++++ ++ + i + kr i +R++ l+++ +a+l++Y e+
tr|F7B7G6|F7B7G6_CIOIN 399 SFVVSEEMELLSQAQARLSSNADDQVMKPYQFKMDEIEGFRYRCKDAIRAVTKRAIHDARVKELRREmLNSAKLKTYFEE 478
889999997778888889999999999*************************************998355689**99986 PP
Internal pipeline statistics summary:
-------------------------------------
Query model(s): 1 (262 nodes)
Target sequences: 16678 (5370518 residues searched)
Passed MSV filter: 1124 (0.0673942); expected 333.6 (0.02)
Passed bias filter: 420 (0.0251829); expected 333.6 (0.02)
Passed Vit filter: 33 (0.00197865); expected 16.7 (0.001)
Passed Fwd filter: 2 (0.000119918); expected 0.2 (1e-05)
Initial search space (Z): 16678 [actual number of targets]
Domain search space (domZ): 2 [number of targets reported over threshold]
# CPU time: 0.14u 0.00s 00:00:00.14 Elapsed: 00:00:00.05
# Mc/sec: 28141.51
//
[ok]