# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  pfam_list/TRM13.hmm.txt
# target sequence database:        proteomes/Pseudomonas_aeruginosa.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TRM13  [M=262]
Accession:   PF05206.13
Description: Methyltransferase TRM13
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
  ------ inclusion threshold ------
       0.15    9.9   1.0          1    7.2   0.0    2.4  3  tr|Q9HU28|Q9HU28_PSEAE  Uncharacterized protein OS=Pseudomona


Domain annotation for each sequence (and alignments):
>> tr|Q9HU28|Q9HU28_PSEAE  Uncharacterized protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.4   0.0     0.074   4.1e+02      20      39 ..      37      56 ..      27      74 .. 0.81
   2 ?   -1.1   1.1      0.06   3.3e+02     105     141 ..     110     139 ..      78     148 .. 0.78
   3 ?    7.2   0.0   0.00018         1     231     261 ..     278     308 ..     274     309 .. 0.94

  Alignments for each domain:
  == domain 1  score: -1.4 bits;  conditional E-value: 0.074
                   TRM13 20 sayvEfGaGkgelsryvnqa 39
                               +++++Gkg+l r +++a
  tr|Q9HU28|Q9HU28_PSEAE 37 VHWLDWCSGKGHLGRLLAHA 56
                            567899*******9999876 PP

  == domain 2  score: -1.1 bits;  conditional E-value: 0.06
                   TRM13 105 HLCGaATDLtLrcllnsekaskkakleglliAlCChh 141
                             H CG   +L Lr l   ++    a  + l++A CC  
  tr|Q9HU28|Q9HU28_PSEAE 110 HACG---ELHLRLLRLASQ----AGCRQLAVAPCCYN 139
                             5555...356665544444....46899*******75 PP

  == domain 3  score: 7.2 bits;  conditional E-value: 0.00018
                   TRM13 231 RllalkekgfeaelvkYvekevslEnvlLla 261
                             R+l+l e+g++++l +++++++s+ n+l+la
  tr|Q9HU28|Q9HU28_PSEAE 278 RCLYLVEQGYSVRLGEFCPTSLSPRNLLILA 308
                             99*************************9987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                              1  (262 nodes)
Target sequences:                         5563  (1857172 residues searched)
Passed MSV filter:                        96  (0.0172569); expected 111.3 (0.02)
Passed bias filter:                       88  (0.0158188); expected 111.3 (0.02)
Passed Vit filter:                         7  (0.00125831); expected 5.6 (0.001)
Passed Fwd filter:                         1  (0.000179759); expected 0.1 (1e-05)
Initial search space (Z):               5563  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.01
# Mc/sec: 48657.91
//
[ok]