# hmmsearch :: search profile(s) against a sequence database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: pfam_list/TYW3.hmm.txt # target sequence database: proteomes/Ornithorhynchus_anatinus.fasta # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TYW3 [M=214] Accession: PF02676.13 Description: Methyltransferase TYW3 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-39 133.9 0.3 1e-38 133.1 0.3 1.3 1 tr|F7ALG1|F7ALG1_ORNAN Uncharacterized protein OS=Ornithorhy Domain annotation for each sequence (and alignments): >> tr|F7ALG1|F7ALG1_ORNAN Uncharacterized protein OS=Ornithorhynchus anatinus OX=9258 PE=4 SV=1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 133.1 0.3 4.6e-43 1e-38 71 213 .. 7 135 .. 2 136 .. 0.95 Alignments for each domain: == domain 1 score: 133.1 bits; conditional E-value: 4.6e-43 T-STT-EEEEEESS---HHHHHHHHCS--..............SSEEEEEEE--EEEEEESSHHHHHHHHHHHHHCT-TT-EEEEEC CS TYW3 71 gkkgggkwlfvsHdpvkeeellaelegleeeeesaksseseeeerlivfkfePmILhvlcrslehAqkllsaAlsaGfreSGivslk 157 +k++++wl+v+H+ + +e+l+ +l++ + + v+kfeP++Lhv+cr+l++Aq l+s+A+++Gfr+SGi+ + tr|F7ALG1|F7ALG1_ORNAN 7 IQKQNCSWLLVTHQLLGREDLILALQKAS---------------GDAVLKFEPFVLHVQCRELQDAQLLHSVAIESGFRNSGITVGR 78 578999********************994...............7889*************************************** PP TTEEEEEEE---EEEEEEESST.S---HHHHHHHHHHHHHHHHHHHHHHHHHHHHC- CS TYW3 158 kkkvivairsglklevpigrkk.llvseeylkllvklanerfeenkkrierfeealk 213 k+k ++a+rs++ levp+++k l+vs+ey+++l+++ane++eenk+rierf+++l+ tr|F7ALG1|F7ALG1_ORNAN 79 KGKTMMAVRSTHVLEVPLSHKGkLMVSQEYIDFLIQIANEKMEENKRRIERFYSRLQ 135 *******************5555******************************9996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (214 nodes) Target sequences: 21677 (8259262 residues searched) Passed MSV filter: 760 (0.0350602); expected 433.5 (0.02) Passed bias filter: 455 (0.02099); expected 433.5 (0.02) Passed Vit filter: 38 (0.00175301); expected 21.7 (0.001) Passed Fwd filter: 3 (0.000138396); expected 0.2 (1e-05) Initial search space (Z): 21677 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.14u 0.00s 00:00:00.14 Elapsed: 00:00:00.05 # Mc/sec: 35349.64 // [ok]