# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  pfam_list/TrmO.hmm.txt
# target sequence database:        proteomes/Pan_troglodytes.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TrmO  [M=119]
Accession:   PF01980.16
Description: tRNA-methyltransferase O
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
    3.7e-42  143.7   0.0      6e-42  143.0   0.0    1.3  1  tr|H2QXJ5|H2QXJ5_PANTR  Chromosome 9 open reading frame 156 O


Domain annotation for each sequence (and alignments):
>> tr|H2QXJ5|H2QXJ5_PANTR  Chromosome 9 open reading frame 156 OS=Pan troglodytes OX=9598 GN=TRMO PE=2 SV=1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  143.0   0.0   2.6e-46     6e-42       1     119 []      45     164 ..      45     164 .. 0.96

  Alignments for each domain:
  == domain 1  score: 143.0 bits;  conditional E-value: 2.6e-46
                             TS-SSGGG--.-EEEEEE-HHH....HGGGTTGGG-SEEEEEEE-TTS...-.SS--E-TT-.SS-E.EGGGS--S-SSS-EEEEEE CS
                    TrmO   1 giPrqpglaeeaeaeielepey..nseealegleefshlwllfvfhenaekklkakvrpprlggnervGvfatRsphRpnpiglsvv 85 
                             g+Prqp++++ ++a +++++++  n+e++l gle+fsh+w+lfvfh+n + ++kakv+pprl+g +++Gvf+tRsphRpn+igl+++
  tr|H2QXJ5|H2QXJ5_PANTR  45 GTPRQPSICSYSRACLRIRKRIfnNPEHSLMGLEQFSHVWILFVFHKNGHLSCKAKVQPPRLNG-AKTGVFSTRSPHRPNAIGLTLA 130
                             79*****************987657899********************99999**********9.666******************* PP

                             EEEEEETTEEEEES----TT-EEEEEEE--HHHH CS
                    TrmO  86 klekvegnvlevsgvDlldgtpvlDiKPYvpyaD 119
                             klekveg  +++sg+D+++gtpvlDiKPY++++D
  tr|H2QXJ5|H2QXJ5_PANTR 131 KLEKVEGGAIYLSGIDMIHGTPVLDIKPYIAEYD 164
                             *******************************998 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                              1  (119 nodes)
Target sequences:                        23008  (11942255 residues searched)
Passed MSV filter:                       316  (0.0137344); expected 460.2 (0.02)
Passed bias filter:                      289  (0.0125608); expected 460.2 (0.02)
Passed Vit filter:                        11  (0.000478095); expected 23.0 (0.001)
Passed Fwd filter:                         1  (4.34631e-05); expected 0.2 (1e-05)
Initial search space (Z):              23008  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.12u 0.01s 00:00:00.13 Elapsed: 00:00:00.07
# Mc/sec: 20301.83
//
[ok]