# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  pfam_list/TrmO.hmm.txt
# target sequence database:        proteomes/Petromyzon_marinus.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TrmO  [M=119]
Accession:   PF01980.16
Description: tRNA-methyltransferase O
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
    1.1e-44  151.0   0.0    1.7e-44  150.5   0.0    1.3  1  tr|S4RUU1|S4RUU1_PETMA  tRNA methyltransferase O OS=Petromyzo


Domain annotation for each sequence (and alignments):
>> tr|S4RUU1|S4RUU1_PETMA  tRNA methyltransferase O OS=Petromyzon marinus OX=7757 PE=4 SV=1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  150.5   0.0   1.2e-48   1.7e-44       1     119 []      38     157 ..      38     157 .. 0.96

  Alignments for each domain:
  == domain 1  score: 150.5 bits;  conditional E-value: 1.2e-48
                             TS-SSGGG--.-EEEEEE-HHH....HGGGTTGGG-SEEEEEEE-TTS...-.SS--E-TT-.SS-E.EGGGS--S-SSS-EEEEEE CS
                    TrmO   1 giPrqpglaeeaeaeielepey..nseealegleefshlwllfvfhenaekklkakvrpprlggnervGvfatRsphRpnpiglsvv 85 
                             g+Prqp+++++++a+++l++++  n e++l gl++fsh+w+lfvfh+n  ++ kakv+pprl+g  +vGvf+tRsphRpnpigls++
  tr|S4RUU1|S4RUU1_PETMA  38 GTPRQPSVCAASRARVRLDKSVfsNAEHSLAGLQHFSHVWILFVFHKNGPTTAKAKVKPPRLNG-LKVGVFSTRSPHRPNPIGLSLA 123
                             79*****************987557899********************88889**********9.899******************* PP

                             EEEEEETTEEEEES----TT-EEEEEEE--HHHH CS
                    TrmO  86 klekvegnvlevsgvDlldgtpvlDiKPYvpyaD 119
                             +lek+eg  l++sg+D++dgtpvlDiKPY+p++D
  tr|S4RUU1|S4RUU1_PETMA 124 RLEKIEGGALYLSGIDMIDGTPVLDIKPYIPEYD 157
                             ********************************99 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                              1  (119 nodes)
Target sequences:                        13539  (5048892 residues searched)
Passed MSV filter:                       467  (0.0344929); expected 270.8 (0.02)
Passed bias filter:                      453  (0.0334589); expected 270.8 (0.02)
Passed Vit filter:                        15  (0.00110791); expected 13.5 (0.001)
Passed Fwd filter:                         1  (7.38607e-05); expected 0.1 (1e-05)
Initial search space (Z):              13539  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.03
# Mc/sec: 20027.27
//
[ok]