# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  pfam_list/TrmO.hmm.txt
# target sequence database:        proteomes/Pseudomonas_aeruginosa.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TrmO  [M=119]
Accession:   PF01980.16
Description: tRNA-methyltransferase O
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
    6.7e-46  153.7   0.0    8.9e-46  153.3   0.0    1.2  1  sp|Q9RPT0|RCSF1_PSEAE  Putative S-adenosylmethionine-dependen


Domain annotation for each sequence (and alignments):
>> sp|Q9RPT0|RCSF1_PSEAE  Putative S-adenosylmethionine-dependent methyltransferase RcsF OS=Pseudomonas aeruginosa (stra
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  153.3   0.0   1.6e-49   8.9e-46       2     119 .]      21     138 ..      20     138 .. 0.99

  Alignments for each domain:
  == domain 1  score: 153.3 bits;  conditional E-value: 1.6e-49
                            S-SSGGG--.-EEEEEE-HHH..HGGGTTGGG-SEEEEEEE-TTS...-.SS--E-TT-.SS-E.EGGGS--S-SSS-EEEEEEEEEE CS
                   TrmO   2 iPrqpglaeeaeaeielepeynseealegleefshlwllfvfhenaekklkakvrpprlggnervGvfatRsphRpnpiglsvvklek 89 
                            iPrqp la++a++++el p++++ ealegle++sh+wllf fh++ e+k + kvrpprlggn+ +GvfatR++hRpn ig svv+le 
  sp|Q9RPT0|RCSF1_PSEAE  21 IPRQPLLAPAARGTLELLPPFDQVEALEGLEQVSHVWLLFLFHQALEDKPRLKVRPPRLGGNRSLGVFATRATHRPNGIGQSVVRLEG 108
                            8********************************************99999************************************** PP

                            EETTEEEEES----TT-EEEEEEE--HHHH CS
                   TrmO  90 vegnvlevsgvDlldgtpvlDiKPYvpyaD 119
                             e  +l +sg+DlldgtpvlDiKPYvpyaD
  sp|Q9RPT0|RCSF1_PSEAE 109 FEAGRLWLSGIDLLDGTPVLDIKPYVPYAD 138
                            ****************************99 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                              1  (119 nodes)
Target sequences:                         5563  (1857172 residues searched)
Passed MSV filter:                        64  (0.0115046); expected 111.3 (0.02)
Passed bias filter:                       63  (0.0113248); expected 111.3 (0.02)
Passed Vit filter:                         6  (0.00107855); expected 5.6 (0.001)
Passed Fwd filter:                         1  (0.000179759); expected 0.1 (1e-05)
Initial search space (Z):               5563  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 11050.17
//
[ok]