# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  pfam_list/TruB_N.hmm.txt
# target sequence database:        proteomes/Dictyostelium_discoideum.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TruB_N  [M=149]
Accession:   PF01509.17
Description: TruB family pseudouridylate synthase (N terminal domain)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------             -----------
    1.5e-18   67.1  10.4    4.3e-15   55.9   0.2    4.1  3  sp|Q54T81|DKC1_DICDI  Probable H/ACA ribonucleoprotein comple


Domain annotation for each sequence (and alignments):
>> sp|Q54T81|DKC1_DICDI  Probable H/ACA ribonucleoprotein complex subunit 4 OS=Dictyostelium discoideum OX=44689 GN=nola
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   55.9   0.2   3.4e-19   4.3e-15       1      53 [.      94     146 ..      94     152 .. 0.94
   2 !   14.1   0.0   2.5e-06     0.032      75     149 .]     151     210 ..     147     210 .. 0.85
   3 ?   -5.7   4.5         1   1.3e+04      57      57 ..     462     462 ..     407     515 .. 0.63

  Alignments for each domain:
  == domain 1  score: 55.9 bits;  conditional E-value: 3.4e-19
                           HHHTT-S-EEESS---TT-EEEEEEEEGGGGGGHHHCTTS-EEEEEEEEETEE CS
                TruB_N   1 krllkakkvGhtGtLDplatGvLvvavgeaTklleylleadKeYeatirlgae 53 
                           + +l+++k Gh+GtLDp++tG+L+v++++aT+l+++ + a KeY+  +rl+ +
  sp|Q54T81|DKC1_DICDI  94 RTILRVTKTGHSGTLDPKVTGCLIVCIERATRLVKSQQGAGKEYIGIVRLHGA 146
                           6899********************************************99865 PP

  == domain 2  score: 14.1 bits;  conditional E-value: 2.5e-06
                           HHHHHHHHHC-EEE---------------------------------EEEEEEEEEEEEEE..EEEEEEEESTTTTH CS
                TruB_N  75 ekleevlkkftGeieqvppmySAvkvnGkrlyelaregeeverkkrkvtiyelelleveep..evelevecskGtYi 149
                           ++l+++++++tG++ q+pp+ SAvk                  + r  ti++ +lle++++     + v+c++GtYi
  sp|Q54T81|DKC1_DICDI 151 TELSKAVDTLTGALFQRPPQKSAVK-----------------KRLRVRTIHNSKLLEFDPErnLGLIWVDCEAGTYI 210
                           5789999999999999999999999.................56788999999999998776567789999999998 PP

  == domain 3  score: -5.7 bits;  conditional E-value: 1
                           S CS
                TruB_N  57 e 57 
                            
  sp|Q54T81|DKC1_DICDI 462 S 462
                           1 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                              1  (149 nodes)
Target sequences:                        12739  (6856946 residues searched)
Passed MSV filter:                       953  (0.0748096); expected 254.8 (0.02)
Passed bias filter:                      349  (0.0273962); expected 254.8 (0.02)
Passed Vit filter:                        20  (0.00156998); expected 12.7 (0.001)
Passed Fwd filter:                         1  (7.84991e-05); expected 0.1 (1e-05)
Initial search space (Z):              12739  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.14u 0.01s 00:00:00.15 Elapsed: 00:00:00.06
# Mc/sec: 17028.08
//
[ok]