# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  pfam_list/TruB_N.hmm.txt
# target sequence database:        proteomes/Natronomonas_moolapensis.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TruB_N  [M=149]
Accession:   PF01509.17
Description: TruB family pseudouridylate synthase (N terminal domain)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
    2.5e-20   70.7   0.4      5e-13   47.0   0.0    3.0  2  tr|M1XSY9|M1XSY9_NATM8  Probable tRNA pseudouridine synthase 


Domain annotation for each sequence (and alignments):
>> tr|M1XSY9|M1XSY9_NATM8  Probable tRNA pseudouridine synthase B OS=Natronomonas moolapensis (strain DSM 18674 / JCM 14
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   47.0   0.0   1.8e-16     5e-13       1      49 [.      39      87 ..      39      93 .. 0.93
   2 !   19.1   0.1   7.2e-08    0.0002     103     149 .]     105     151 ..      91     151 .. 0.82

  Alignments for each domain:
  == domain 1  score: 47.0 bits;  conditional E-value: 1.8e-16
                            HHHTT-S-EEESS---TT-EEEEEEEEGGGGGGHHHCTTS-EEEEEEEE CS
                  TruB_N  1 krllkakkvGhtGtLDplatGvLvvavgeaTklleylleadKeYeatir 49
                            + + +++++ h+GtLDp++tG+L++++g+aT++++++ +++K Y+a+++
  tr|M1XSY9|M1XSY9_NATM8 39 RDMAGVDRAAHAGTLDPKVTGCLPILTGTATRAAQVFDDSRKGYVAVLE 87
                            5678999**************************************9987 PP

  == domain 2  score: 19.1 bits;  conditional E-value: 7.2e-08
                             -------------------EEEEEEEEEEEEEEEEEEEEEESTTTTH CS
                  TruB_N 103 krlyelaregeeverkkrkvtiyelelleveepevelevecskGtYi 149
                             + ly+   +  +v r+ r+ +i++le le ee+++ l++ec +GtYi
  tr|M1XSY9|M1XSY9_NATM8 105 TALYQKPPRKSAVVRRLRTREIHRLEALEREERRALLDIECASGTYI 151
                             4456666666667799******************************9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                              1  (149 nodes)
Target sequences:                         2723  (809592 residues searched)
Passed MSV filter:                        69  (0.0253397); expected 54.5 (0.02)
Passed bias filter:                       65  (0.0238707); expected 54.5 (0.02)
Passed Vit filter:                         4  (0.00146897); expected 2.7 (0.001)
Passed Fwd filter:                         1  (0.000367242); expected 0.0 (1e-05)
Initial search space (Z):               2723  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 12062.92
//
[ok]