# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  pfam_list/TruB_N.hmm.txt
# target sequence database:        proteomes/Pseudomonas_aeruginosa.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TruB_N  [M=149]
Accession:   PF01509.17
Description: TruB family pseudouridylate synthase (N terminal domain)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------             -----------
    1.4e-57  192.6   0.0    1.8e-57  192.3   0.0    1.1  1  sp|P72154|TRUB_PSEAE  tRNA pseudouridine synthase B OS=Pseudo
  ------ inclusion threshold ------
      0.015   14.0   0.2      0.037   12.8   0.1    1.6  1  sp|P33640|RLUD_PSEAE  Ribosomal large subunit pseudouridine s


Domain annotation for each sequence (and alignments):
>> sp|P72154|TRUB_PSEAE  tRNA pseudouridine synthase B OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 10
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  192.3   0.0   6.4e-61   1.8e-57       1     149 []      33     180 ..      33     180 .. 0.98

  Alignments for each domain:
  == domain 1  score: 192.3 bits;  conditional E-value: 6.4e-61
                           HHHTT-S-EEESS---TT-EEEEEEEEGGGGGGHHHCTTS-EEEEEEEEETEEETTSBTTS-EEE-.--TT--HHHHHHHHHHC-EEE- CS
                TruB_N   1 krllkakkvGhtGtLDplatGvLvvavgeaTklleylleadKeYeatirlgaetdteDaegeileeekveklteekleevlkkftGeie 89 
                           ++ll+a+k+GhtG+LDplatGvL++++geaTk+++yll+adK Ye+++r+g++t+t Daege l+e+   ++ +++le++l +f+G+ie
  sp|P72154|TRUB_PSEAE  33 RWLLNAEKAGHTGSLDPLATGVLPLCFGEATKFSQYLLDADKGYETVMRMGITTTTGDAEGELLAER-DVTVGRDDLEQALPRFRGDIE 120
                           6789************************************************************994.899****************** PP

                           --------------------------------EEEEEEEEEEEEEEEEEEEEEESTTTTH CS
                TruB_N  90 qvppmySAvkvnGkrlyelaregeeverkkrkvtiyelelleveepevelevecskGtYi 149
                           qvppmySA+k++G++ly+lar+ge ver++r+vti++l+ll++e+p ++l v+cskGtY+
  sp|P72154|TRUB_PSEAE 121 QVPPMYSALKKDGQPLYKLARAGEVVEREARSVTITRLDLLSFEPPCATLAVSCSKGTYV 180
                           ***********************************************************8 PP

>> sp|P33640|RLUD_PSEAE  Ribosomal large subunit pseudouridine synthase D OS=Pseudomonas aeruginosa (strain ATCC 15692 /
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.8   0.1   1.3e-05     0.037       4      47 ..     126     173 ..     124     196 .. 0.83

  Alignments for each domain:
  == domain 1  score: 12.8 bits;  conditional E-value: 1.3e-05
                           TT-S-EEESS---TT-EEEEEEE..EGGGGGGHHHCTTS-..EEEEEE CS
                TruB_N   4 lkakkvGhtGtLDplatGvLvva..vgeaTklleyllead..KeYeat 47 
                            ++ ++G  + LD+  tG++vva  ++  Tkl+ +l+  +  + Yea 
  sp|P33640|RLUD_PSEAE 126 ANVPRAGIVHRLDKDTTGLMVVAktLEAHTKLVAQLQARSvsRIYEAI 173
                           57789*****************755899*******9965434777775 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                              1  (149 nodes)
Target sequences:                         5563  (1857172 residues searched)
Passed MSV filter:                        98  (0.0176164); expected 111.3 (0.02)
Passed bias filter:                       90  (0.0161783); expected 111.3 (0.02)
Passed Vit filter:                        12  (0.00215711); expected 5.6 (0.001)
Passed Fwd filter:                         2  (0.000359518); expected 0.1 (1e-05)
Initial search space (Z):               5563  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 13835.93
//
[ok]