# hmmsearch :: search profile(s) against a sequence database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: pfam_list/TruB_N.hmm.txt # target sequence database: proteomes/Trypanosoma_brucei.fasta # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TruB_N [M=149] Accession: PF01509.17 Description: TruB family pseudouridylate synthase (N terminal domain) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-22 78.4 1.8 2e-16 59.6 0.2 3.1 2 tr|Q38CM1|Q38CM1_TRYB2 Centromere/microtubule binding protei Domain annotation for each sequence (and alignments): >> tr|Q38CM1|Q38CM1_TRYB2 Centromere/microtubule binding protein cbf5, putative OS=Trypanosoma brucei brucei (strain 92 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.6 0.2 2.3e-20 2e-16 1 56 [. 91 146 .. 91 149 .. 0.95 2 ! 16.9 0.2 3.5e-07 0.003 71 149 .] 143 206 .. 141 206 .. 0.90 Alignments for each domain: == domain 1 score: 59.6 bits; conditional E-value: 2.3e-20 HHHTT-S-EEESS---TT-EEEEEEEEGGGGGGHHHCTTS-EEEEEEEEETEEETT CS TruB_N 1 krllkakkvGhtGtLDplatGvLvvavgeaTklleylleadKeYeatirlgaetdt 56 kr+lk +k Gh+GtLDp++tG L++++++aT+l+++ ++a K+Y+ ++rl+ + ++ tr|Q38CM1|Q38CM1_TRYB2 91 KRILKCEKTGHAGTLDPKVTGALIICIDRATRLVKSQQNAGKTYIGVLRLHDTVSE 146 89************************************************988765 PP == domain 2 score: 16.9 bits; conditional E-value: 3.5e-07 T--HHHHHHHHHHC-EEE---------------------------------EEEEEEEEEEEEEE..EEEEEEEESTTTTH CS TruB_N 71 klteekleevlkkftGeieqvppmySAvkvnGkrlyelaregeeverkkrkvtiyelelleveep..evelevecskGtYi 149 +++e+k+ + l+++tG q+pp ++Avk r+ r +iy+ +l+e++++ + +e++c++GtYi tr|Q38CM1|Q38CM1_TRYB2 143 TVSEKKVVASLQRLTGPCFQRPPLIAAVK-----------------RQLRIRNIYSNQLIEYDKHrhLAVFETHCEAGTYI 206 57888999999999999999999999999.................999*************98877899**********8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (149 nodes) Target sequences: 8561 (4332363 residues searched) Passed MSV filter: 256 (0.029903); expected 171.2 (0.02) Passed bias filter: 181 (0.0211424); expected 171.2 (0.02) Passed Vit filter: 13 (0.00151851); expected 8.6 (0.001) Passed Fwd filter: 1 (0.000116809); expected 0.1 (1e-05) Initial search space (Z): 8561 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03 # Mc/sec: 21517.40 // [ok]