# hmmsearch :: search profile(s) against a sequence database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: pfam_list/TruD.hmm.txt # target sequence database: proteomes/Thermococcus_kodakarensis.fasta # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TruD [M=416] Accession: PF01142.17 Description: tRNA pseudouridine synthase D (TruD) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-137 455.1 0.0 3.1e-137 454.9 0.0 1.0 1 sp|Q5JDB6|TRUD_THEKO Probable tRNA pseudouridine synthase D Domain annotation for each sequence (and alignments): >> sp|Q5JDB6|TRUD_THEKO Probable tRNA pseudouridine synthase D OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 454.9 0.0 1.3e-140 3.1e-137 7 416 .] 12 412 .. 7 412 .. 0.96 Alignments for each domain: == domain 1 score: 454.9 bits; conditional E-value: 1.3e-140 TruD 7 yvtdtegigGrlrespeDFiVeEieefsgeeeakegeylvlrvekrnwdtldlvrelaralgisrkrvgfaGtKDkrAvTtQlisirkv 95 ++++++gigG+++ peDFiV E + s + +y ++ ++krnw+t+ +v+e+a+++gi+ +++gfaGtKD++AvT+Q+is+ sp|Q5JDB6|TRUD_THEKO 12 HLSEKPGIGGKIKIYPEDFIVIEEPIPS---IFEGRKYAIFLLKKRNWETMAAVKEIAKRAGINYREIGFAGTKDRHAVTYQYISVPAE 97 6789*****************8874443...3567899************************************************999 PP TruD 96 epeelekleikdvelevvgrarrklrlGdLaGNkFeirvrdvaeeeeaakraeeileelkekggvPNyfGvQRFGsrrpvthlvGkaiv 184 e++e+++i+d+el+ v +r ++lG+L GN+F+i+vrdv +e+a +r++ei++el+ekgg+PNyfG+QRFG+rr v+h++Gk ++ sp|Q5JDB6|TRUD_THEKO 98 ARERVEQVSIRDIELRFVS-YGRFIKLGHLLGNRFRIIVRDV--SEDAFDRTKEIVRELREKGGFPNYFGYQRFGERRVVNHIIGKLLL 183 99*************9987.78*******************8..456899*************************************** PP TruD 185 kgdleeAveayvgkpfeeesedtreareavaetgdleealeelpkslryEramlkrLaekpkdykkAlealpknLqrlFvhAyqSylFN 273 +gd+e+A++ ++g + +++ d ear++++etgd+e+alee+p lryEr++l+r+++ ++++k+A+ +lp ++ r+F+hAyqSylFN sp|Q5JDB6|TRUD_THEKO 184 QGDFEGAARLFLGAHDGSMEGD--EARKNFWETGDVERALEEFPGFLRYERTLLHRYKD-TGNWKRAFLSLPLPIMRIFIHAYQSYLFN 269 **************99999888..9*********************************9.***************************** PP TruD 274 rvlseRlerglpldepveGDvvifaeerlpdtdrlqlvteknveevkrliergrafvtaplvGtetelaegevgeierevleeeglele 362 +ls+R+e+glpl+ep+ GD+v++ + +p +dr+ +vte+n+e v++++++++a+v++pl+G+ ++ a+g +ge+e+e+leeegl+le sp|Q5JDB6|TRUD_THEKO 270 LYLSRRIEEGLPLNEPLVGDIVVQVKGGIPYRDRTYRVTETNLEFVREKVRKNQAMVSGPLFGFAMRRAKGLPGELEKEILEEEGLSLE 358 ***************************************************************************************** PP TruD 363 dFk.lpklpelsskGtrRaillrvedlelsaeede.ltleFsLpkGsYATvvlrEi 416 F+ lpk +++ G rR++llr++ +++ ++e ++++F+LpkG+YAT+vlrEi sp|Q5JDB6|TRUD_THEKO 359 TFRrLPK--PMAEPGGRRELLLRPMGMAYGYIQEEgMCFRFFLPKGTYATSVLREI 412 ***9999..****************99998765555*******************7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (416 nodes) Target sequences: 2301 (637680 residues searched) Passed MSV filter: 84 (0.0365059); expected 46.0 (0.02) Passed bias filter: 62 (0.0269448); expected 46.0 (0.02) Passed Vit filter: 5 (0.00217297); expected 2.3 (0.001) Passed Fwd filter: 1 (0.000434594); expected 0.0 (1e-05) Initial search space (Z): 2301 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 26527.49 // [ok]