# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  pfam_list/WBS_methylT.hmm.txt
# target sequence database:        proteomes/Ciona_intestinalis.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       WBS_methylT  [M=82]
Accession:   PF12589.7
Description: Methyltransferase involved in Williams-Beuren syndrome
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
    2.5e-20   72.9  10.0    4.5e-20   72.1  10.0    1.4  1  tr|F6TFE2|F6TFE2_CIOIN  Uncharacterized protein OS=Ciona inte


Domain annotation for each sequence (and alignments):
>> tr|F6TFE2|F6TFE2_CIOIN  Uncharacterized protein OS=Ciona intestinalis OX=7719 PE=4 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   72.1  10.0   2.7e-24   4.5e-20       1      82 []     204     281 ..     204     281 .. 0.90

  Alignments for each domain:
  == domain 1  score: 72.1 bits;  conditional E-value: 2.7e-24
             WBS_methylT   1 LfaGkseqqqlpkglgedgeeeseeaeqvkyekrrrkrkkrkkkkkkavksreWilkKKerrrkkGkeVkrdSKYTGRkRka 82 
                             Lf+G  ++ +lpk+lg+++e++++  +q+ky k+r++r + k++k+  +ksr+Wi++KKerr+++GkeV  ++KYTGRkRk+
  tr|F6TFE2|F6TFE2_CIOIN 204 LFCG-VASPTLPKALGTEEEAKKK--RQIKYVKEREQRGSDKRNKS-IKKSRDWIIEKKERRKRQGKEVSINTKYTGRKRKP 281
                             89**.8999**********88766..******99998886665555.789******************************95 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                              1  (82 nodes)
Target sequences:                        16678  (5370518 residues searched)
Passed MSV filter:                      1548  (0.0928169); expected 333.6 (0.02)
Passed bias filter:                      423  (0.0253628); expected 333.6 (0.02)
Passed Vit filter:                        42  (0.00251829); expected 16.7 (0.001)
Passed Fwd filter:                         2  (0.000119918); expected 0.2 (1e-05)
Initial search space (Z):              16678  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.09u 0.00s 00:00:00.09 Elapsed: 00:00:00.04
# Mc/sec: 11009.56
//
[ok]