# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  pfam_list/WBS_methylT.hmm.txt
# target sequence database:        proteomes/Homo_sapiens.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       WBS_methylT  [M=82]
Accession:   PF12589.7
Description: Methyltransferase involved in Williams-Beuren syndrome
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
      5e-16   61.4   0.5    8.3e-16   60.7   0.5    1.4  1  sp|O43709|WBS22_HUMAN   Uncharacterized methyltransferase WBS
    5.5e-15   58.1   2.6      1e-14   57.3   2.6    1.4  1  tr|C9K060|C9K060_HUMAN  Uncharacterized methyltransferase WBS
      1e-13   54.1   3.7    1.1e-13   54.0   3.7    1.1  1  tr|H7C0G4|H7C0G4_HUMAN  Uncharacterized methyltransferase WBS


Domain annotation for each sequence (and alignments):
>> sp|O43709|WBS22_HUMAN  Uncharacterized methyltransferase WBSCR22 OS=Homo sapiens GN=WBSCR22 PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   60.7   0.5   2.8e-20   8.3e-16       1      82 []     204     279 ..     204     279 .. 0.85

  Alignments for each domain:
  == domain 1  score: 60.7 bits;  conditional E-value: 2.8e-20
            WBS_methylT   1 LfaGkseqqqlpkglgedgeeeseeaeqvkyekrrrkrkkrkkkkkkavksreWilkKKerrrkkGkeVkrdSKYTGRkRka 82 
                            Lf+G   ++ +p+gl+e+++e +  +e+v  ++r   r +r++  +   ksr W+l+KKer r++G+eV++d++YTGRkRk+
  sp|O43709|WBS22_HUMAN 204 LFSG--PSTFIPEGLSENQDEVE-PRESVFTNERFPLRMSRRGMVR---KSRAWVLEKKERHRRQGREVRPDTQYTGRKRKP 279
                            7888..8999*****99996655.4888877777777777777777...5******************************95 PP

>> tr|C9K060|C9K060_HUMAN  Uncharacterized methyltransferase WBSCR22 OS=Homo sapiens GN=WBSCR22 PE=2 SV=1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   57.3   2.6   3.4e-19     1e-14       1      82 []     204     296 ..     204     296 .. 0.77

  Alignments for each domain:
  == domain 1  score: 57.3 bits;  conditional E-value: 3.4e-19
             WBS_methylT   1 LfaGkseqqqlpkglgedgeeeseeaeqvkyekrrrkrkkrkkkkkkavk..............sreWilkKKerrrkkGkeVkrdS 73 
                             Lf+G   ++ +p+gl+e+++e +  +e+v  ++r+  + +r++ + ++++              sr W+l+KKer r++G+eV++d+
  tr|C9K060|C9K060_HUMAN 204 LFSG--PSTFIPEGLSENQDEVEP-RESVFTNEREGGAFERRGIRGHQTRrfplrmsrrgmvrkSRAWVLEKKERHRRQGREVRPDT 287
                             7888..8999*****999976655.666766666665555544444333356777888888888*********************** PP

             WBS_methylT  74 KYTGRkRka 82 
                             +YTGRkRk+
  tr|C9K060|C9K060_HUMAN 288 QYTGRKRKP 296
                             *******95 PP

>> tr|H7C0G4|H7C0G4_HUMAN  Uncharacterized methyltransferase WBSCR22 (Fragment) OS=Homo sapiens GN=WBSCR22 PE=4 SV=1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   54.0   3.7   3.6e-18   1.1e-13      44      82 .]      25      63 ..       6      63 .. 0.79

  Alignments for each domain:
  == domain 1  score: 54.0 bits;  conditional E-value: 3.6e-18
             WBS_methylT 44 kkkkavksreWilkKKerrrkkGkeVkrdSKYTGRkRka 82
                            ++    ksr W+l+KKer r++G+eV++d++YTGRkRk+
  tr|H7C0G4|H7C0G4_HUMAN 25 RRGMVRKSRAWVLEKKERHRRQGREVRPDTQYTGRKRKP 63
                            2223346******************************95 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                              1  (82 nodes)
Target sequences:                        88473  (35070517 residues searched)
Passed MSV filter:                      7754  (0.0876426); expected 1769.5 (0.02)
Passed bias filter:                     2543  (0.0287432); expected 1769.5 (0.02)
Passed Vit filter:                       217  (0.00245273); expected 88.5 (0.001)
Passed Fwd filter:                         8  (9.04231e-05); expected 0.9 (1e-05)
Initial search space (Z):              88473  [actual number of targets]
Domain search space  (domZ):               3  [number of targets reported over threshold]
# CPU time: 0.58u 0.02s 00:00:00.60 Elapsed: 00:00:00.23
# Mc/sec: 12503.40
//
[ok]