# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file: pfam_list/WBS_methylT.hmm.txt
# target sequence database: proteomes/Homo_sapiens.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query: WBS_methylT [M=82]
Accession: PF12589.7
Description: Methyltransferase involved in Williams-Beuren syndrome
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5e-16 61.4 0.5 8.3e-16 60.7 0.5 1.4 1 sp|O43709|WBS22_HUMAN Uncharacterized methyltransferase WBS
5.5e-15 58.1 2.6 1e-14 57.3 2.6 1.4 1 tr|C9K060|C9K060_HUMAN Uncharacterized methyltransferase WBS
1e-13 54.1 3.7 1.1e-13 54.0 3.7 1.1 1 tr|H7C0G4|H7C0G4_HUMAN Uncharacterized methyltransferase WBS
Domain annotation for each sequence (and alignments):
>> sp|O43709|WBS22_HUMAN Uncharacterized methyltransferase WBSCR22 OS=Homo sapiens GN=WBSCR22 PE=1 SV=2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 60.7 0.5 2.8e-20 8.3e-16 1 82 [] 204 279 .. 204 279 .. 0.85
Alignments for each domain:
== domain 1 score: 60.7 bits; conditional E-value: 2.8e-20
WBS_methylT 1 LfaGkseqqqlpkglgedgeeeseeaeqvkyekrrrkrkkrkkkkkkavksreWilkKKerrrkkGkeVkrdSKYTGRkRka 82
Lf+G ++ +p+gl+e+++e + +e+v ++r r +r++ + ksr W+l+KKer r++G+eV++d++YTGRkRk+
sp|O43709|WBS22_HUMAN 204 LFSG--PSTFIPEGLSENQDEVE-PRESVFTNERFPLRMSRRGMVR---KSRAWVLEKKERHRRQGREVRPDTQYTGRKRKP 279
7888..8999*****99996655.4888877777777777777777...5******************************95 PP
>> tr|C9K060|C9K060_HUMAN Uncharacterized methyltransferase WBSCR22 OS=Homo sapiens GN=WBSCR22 PE=2 SV=1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 57.3 2.6 3.4e-19 1e-14 1 82 [] 204 296 .. 204 296 .. 0.77
Alignments for each domain:
== domain 1 score: 57.3 bits; conditional E-value: 3.4e-19
WBS_methylT 1 LfaGkseqqqlpkglgedgeeeseeaeqvkyekrrrkrkkrkkkkkkavk..............sreWilkKKerrrkkGkeVkrdS 73
Lf+G ++ +p+gl+e+++e + +e+v ++r+ + +r++ + ++++ sr W+l+KKer r++G+eV++d+
tr|C9K060|C9K060_HUMAN 204 LFSG--PSTFIPEGLSENQDEVEP-RESVFTNEREGGAFERRGIRGHQTRrfplrmsrrgmvrkSRAWVLEKKERHRRQGREVRPDT 287
7888..8999*****999976655.666766666665555544444333356777888888888*********************** PP
WBS_methylT 74 KYTGRkRka 82
+YTGRkRk+
tr|C9K060|C9K060_HUMAN 288 QYTGRKRKP 296
*******95 PP
>> tr|H7C0G4|H7C0G4_HUMAN Uncharacterized methyltransferase WBSCR22 (Fragment) OS=Homo sapiens GN=WBSCR22 PE=4 SV=1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 54.0 3.7 3.6e-18 1.1e-13 44 82 .] 25 63 .. 6 63 .. 0.79
Alignments for each domain:
== domain 1 score: 54.0 bits; conditional E-value: 3.6e-18
WBS_methylT 44 kkkkavksreWilkKKerrrkkGkeVkrdSKYTGRkRka 82
++ ksr W+l+KKer r++G+eV++d++YTGRkRk+
tr|H7C0G4|H7C0G4_HUMAN 25 RRGMVRKSRAWVLEKKERHRRQGREVRPDTQYTGRKRKP 63
2223346******************************95 PP
Internal pipeline statistics summary:
-------------------------------------
Query model(s): 1 (82 nodes)
Target sequences: 88473 (35070517 residues searched)
Passed MSV filter: 7754 (0.0876426); expected 1769.5 (0.02)
Passed bias filter: 2543 (0.0287432); expected 1769.5 (0.02)
Passed Vit filter: 217 (0.00245273); expected 88.5 (0.001)
Passed Fwd filter: 8 (9.04231e-05); expected 0.9 (1e-05)
Initial search space (Z): 88473 [actual number of targets]
Domain search space (domZ): 3 [number of targets reported over threshold]
# CPU time: 0.58u 0.02s 00:00:00.60 Elapsed: 00:00:00.23
# Mc/sec: 12503.40
//
[ok]