# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file: pfam_list/WBS_methylT.hmm.txt
# target sequence database: proteomes/Monosiga_brevicollis.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query: WBS_methylT [M=82]
Accession: PF12589.7
Description: Methyltransferase involved in Williams-Beuren syndrome
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-15 57.0 10.5 2.2e-15 56.2 10.5 1.4 1 tr|A9UXF0|A9UXF0_MONBE Predicted protein OS=Monosiga brevico
------ inclusion threshold ------
8.8 6.2 12.0 1.6 8.6 7.1 2.2 2 tr|A9VDI0|A9VDI0_MONBE Predicted protein OS=Monosiga brevico
Domain annotation for each sequence (and alignments):
>> tr|A9UXF0|A9UXF0_MONBE Predicted protein OS=Monosiga brevicollis OX=81824 GN=18922 PE=4 SV=1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 56.2 10.5 4.7e-19 2.2e-15 1 81 [. 197 272 .. 197 273 .. 0.82
Alignments for each domain:
== domain 1 score: 56.2 bits; conditional E-value: 4.7e-19
WBS_methylT 1 LfaGkseqqqlpkglgedgeeeseeaeqvkyekrrrkrkkrkkkkkkavksreWilkKKerrrkk.Gk.eVkrdSKYTGRkRk 81
LfaG + ++p+g+++++ ++++ + +++k++r++k++++ k+r+Wi++KKerrrk+ G+ eV++d+KYTGRkR
tr|A9UXF0|A9UXF0_MONBE 197 LFAG--VVGNVPRGKTGEEGANQQ-SAGASFSKQERRDKRKQRAT----KGRDWIMQKKERRRKQiGQrEVRPDTKYTGRKRA 272
7888..8999*****999966554.67777777777666444444....49*******************************6 PP
>> tr|A9VDI0|A9VDI0_MONBE Predicted protein OS=Monosiga brevicollis OX=81824 GN=39286 PE=4 SV=1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -1.7 0.1 0.56 2.6e+03 26 47 .. 99 120 .. 83 143 .. 0.62
2 ? 8.6 7.1 0.00034 1.6 12 66 .. 395 449 .. 389 456 .. 0.81
Alignments for each domain:
== domain 1 score: -1.7 bits; conditional E-value: 0.56
WBS_methylT 26 aeqvkyekrrrkrkkrkkkkkk 47
qv++e+ r+++kk++++ k
tr|A9VDI0|A9VDI0_MONBE 99 LGQVNCEDPRAQHKKSENGITK 120
4577777777777666554443 PP
== domain 2 score: 8.6 bits; conditional E-value: 0.00034
WBS_methylT 12 pkglgedgeeeseeaeqvkyekrrrkrkkrkkkkkkavksreWilkKKerrrkkG 66
p +++e+ +e+ e+a+q k +++++ + + ++ ++ k++++i +KKe++ + G
tr|A9VDI0|A9VDI0_MONBE 395 PDARKETIKEQLEDAQQLKQQQEKNAQAVQDAESASQRKAQDFINQKKEQAARTG 449
556666666677788999988888888888888888888***********99988 PP
Internal pipeline statistics summary:
-------------------------------------
Query model(s): 1 (82 nodes)
Target sequences: 9188 (5511963 residues searched)
Passed MSV filter: 819 (0.089138); expected 183.8 (0.02)
Passed bias filter: 242 (0.0263387); expected 183.8 (0.02)
Passed Vit filter: 25 (0.00272094); expected 9.2 (0.001)
Passed Fwd filter: 3 (0.000326513); expected 0.1 (1e-05)
Initial search space (Z): 9188 [actual number of targets]
Domain search space (domZ): 2 [number of targets reported over threshold]
# CPU time: 0.09u 0.00s 00:00:00.09 Elapsed: 00:00:00.04
# Mc/sec: 11299.52
//
[ok]