# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  pfam_list/WBS_methylT.hmm.txt
# target sequence database:        proteomes/Monosiga_brevicollis.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       WBS_methylT  [M=82]
Accession:   PF12589.7
Description: Methyltransferase involved in Williams-Beuren syndrome
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------               -----------
    1.2e-15   57.0  10.5    2.2e-15   56.2  10.5    1.4  1  tr|A9UXF0|A9UXF0_MONBE  Predicted protein OS=Monosiga brevico
  ------ inclusion threshold ------
        8.8    6.2  12.0        1.6    8.6   7.1    2.2  2  tr|A9VDI0|A9VDI0_MONBE  Predicted protein OS=Monosiga brevico


Domain annotation for each sequence (and alignments):
>> tr|A9UXF0|A9UXF0_MONBE  Predicted protein OS=Monosiga brevicollis OX=81824 GN=18922 PE=4 SV=1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   56.2  10.5   4.7e-19   2.2e-15       1      81 [.     197     272 ..     197     273 .. 0.82

  Alignments for each domain:
  == domain 1  score: 56.2 bits;  conditional E-value: 4.7e-19
             WBS_methylT   1 LfaGkseqqqlpkglgedgeeeseeaeqvkyekrrrkrkkrkkkkkkavksreWilkKKerrrkk.Gk.eVkrdSKYTGRkRk 81 
                             LfaG  +  ++p+g+++++ ++++ +   +++k++r++k++++      k+r+Wi++KKerrrk+ G+ eV++d+KYTGRkR 
  tr|A9UXF0|A9UXF0_MONBE 197 LFAG--VVGNVPRGKTGEEGANQQ-SAGASFSKQERRDKRKQRAT----KGRDWIMQKKERRRKQiGQrEVRPDTKYTGRKRA 272
                             7888..8999*****999966554.67777777777666444444....49*******************************6 PP

>> tr|A9VDI0|A9VDI0_MONBE  Predicted protein OS=Monosiga brevicollis OX=81824 GN=39286 PE=4 SV=1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.7   0.1      0.56   2.6e+03      26      47 ..      99     120 ..      83     143 .. 0.62
   2 ?    8.6   7.1   0.00034       1.6      12      66 ..     395     449 ..     389     456 .. 0.81

  Alignments for each domain:
  == domain 1  score: -1.7 bits;  conditional E-value: 0.56
             WBS_methylT  26 aeqvkyekrrrkrkkrkkkkkk 47 
                               qv++e+ r+++kk++++  k
  tr|A9VDI0|A9VDI0_MONBE  99 LGQVNCEDPRAQHKKSENGITK 120
                             4577777777777666554443 PP

  == domain 2  score: 8.6 bits;  conditional E-value: 0.00034
             WBS_methylT  12 pkglgedgeeeseeaeqvkyekrrrkrkkrkkkkkkavksreWilkKKerrrkkG 66 
                             p +++e+ +e+ e+a+q k +++++ +  +  ++ ++ k++++i +KKe++ + G
  tr|A9VDI0|A9VDI0_MONBE 395 PDARKETIKEQLEDAQQLKQQQEKNAQAVQDAESASQRKAQDFINQKKEQAARTG 449
                             556666666677788999988888888888888888888***********99988 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                              1  (82 nodes)
Target sequences:                         9188  (5511963 residues searched)
Passed MSV filter:                       819  (0.089138); expected 183.8 (0.02)
Passed bias filter:                      242  (0.0263387); expected 183.8 (0.02)
Passed Vit filter:                        25  (0.00272094); expected 9.2 (0.001)
Passed Fwd filter:                         3  (0.000326513); expected 0.1 (1e-05)
Initial search space (Z):               9188  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.09u 0.00s 00:00:00.09 Elapsed: 00:00:00.04
# Mc/sec: 11299.52
//
[ok]