# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file: pfam_list/zf-GRF.hmm.txt
# target sequence database: proteomes/Amphimedon_queenslandica.fasta
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query: zf-GRF [M=45]
Accession: PF06839.12
Description: GRF zinc finger
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3e-30 105.3 10.2 9.1e-15 55.7 0.9 3.0 2 tr|A0A1X7UTP9|A0A1X7UTP9_AMPQE DNA topoisomerase OS=Amphimedon
2.1e-12 48.2 2.7 4.8e-12 47.0 2.7 1.7 1 tr|A0A1X7VD76|A0A1X7VD76_AMPQE DNA-(apurinic or apyrimidinic si
------ inclusion threshold ------
0.011 17.1 0.7 0.016 16.5 0.7 1.2 1 tr|A0A1X7TBK2|A0A1X7TBK2_AMPQE Uncharacterized protein OS=Amphi
0.025 15.9 0.7 0.05 14.9 0.7 1.5 1 tr|A0A1X7T2K3|A0A1X7T2K3_AMPQE Uncharacterized protein OS=Amphi
0.035 15.4 0.0 0.053 14.9 0.0 1.2 1 tr|A0A1X7VSR7|A0A1X7VSR7_AMPQE Uncharacterized protein OS=Amphi
0.062 14.6 0.7 0.15 13.4 0.7 1.6 1 tr|A0A1X7TBJ0|A0A1X7TBJ0_AMPQE Uncharacterized protein OS=Amphi
0.099 14.0 0.5 0.14 13.5 0.5 1.2 1 tr|A0A1X7UY93|A0A1X7UY93_AMPQE Uncharacterized protein OS=Amphi
0.63 11.4 0.5 1.3 10.4 0.5 1.5 1 tr|A0A1X7UGJ6|A0A1X7UGJ6_AMPQE Uncharacterized protein OS=Amphi
Domain annotation for each sequence (and alignments):
>> tr|A0A1X7UTP9|A0A1X7UTP9_AMPQE DNA topoisomerase OS=Amphimedon queenslandica OX=400682 PE=3 SV=1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 55.7 0.9 1.7e-18 9.1e-15 2 44 .. 806 850 .. 805 851 .. 0.90
2 ! 53.1 2.7 1.1e-17 6.1e-14 2 44 .. 909 950 .. 908 951 .. 0.97
Alignments for each domain:
== domain 1 score: 55.7 bits; conditional E-value: 1.7e-18
zf-GRF 2 lCkcgrlavlltvrk.tgpNkGRkFYkCpkgke.kqCgFFkWade 44
C+cg +a lltvr+ + NkGR+FYkC+k++e +C+FF Wade
tr|A0A1X7UTP9|A0A1X7UTP9_AMPQE 806 VCNCGIEAILLTVRNeQSINKGRQFYKCAKRDEeGKCNFFLWADE 850
7************982456*************9999********8 PP
== domain 2 score: 53.1 bits; conditional E-value: 1.1e-17
zf-GRF 2 lCkcgrlavlltvrktgpNkGRkFYkCpkgkekqCgFFkWade 44
+C cg +av++tv+ g N+GR F +Cpk++++qCgFF+W d+
tr|A0A1X7UTP9|A0A1X7UTP9_AMPQE 909 TCRCGLPAVQRTVQ-SGNNQGRLFRTCPKPRDEQCGFFEWMDN 950
7************8.**************************97 PP
>> tr|A0A1X7VD76|A0A1X7VD76_AMPQE DNA-(apurinic or apyrimidinic site) lyase OS=Amphimedon queenslandica OX=400682 PE=3
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 47.0 2.7 8.8e-16 4.8e-12 1 42 [. 389 437 .. 389 438 .] 0.93
Alignments for each domain:
== domain 1 score: 47.0 bits; conditional E-value: 8.8e-16
zf-GRF 1 plCk.cgrlavlltvrktgpNkGRkFYkCpkgke......kqCgFFkWa 42
plC + ++avl++v+k gpN+ RkFY+C +++ ++C+FFkW+
tr|A0A1X7VD76|A0A1X7VD76_AMPQE 389 PLCSgHKEPAVLRVVKKPGPNHNRKFYVCGRPDGskhdpnASCNFFKWC 437
69*9888**********************9999888999999******9 PP
>> tr|A0A1X7TBK2|A0A1X7TBK2_AMPQE Uncharacterized protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? 16.5 0.7 2.9e-06 0.016 2 23 .. 69 90 .. 68 91 .. 0.94
Alignments for each domain:
== domain 1 score: 16.5 bits; conditional E-value: 2.9e-06
zf-GRF 2 lCkcgrlavlltvrktgpNkGR 23
C c ++++ +v+++g+N+G+
tr|A0A1X7TBK2|A0A1X7TBK2_AMPQE 69 YCLCKHRSTTHVVQRNGKNQGQ 90
5*******************96 PP
>> tr|A0A1X7T2K3|A0A1X7T2K3_AMPQE Uncharacterized protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? 14.9 0.7 9.2e-06 0.05 2 23 .. 176 197 .. 175 198 .. 0.94
Alignments for each domain:
== domain 1 score: 14.9 bits; conditional E-value: 9.2e-06
zf-GRF 2 lCkcgrlavlltvrktgpNkGR 23
C c ++++ +v+++g+N+G+
tr|A0A1X7T2K3|A0A1X7T2K3_AMPQE 176 YCLCKHRSTTHVVQRNGKNQGQ 197
5*******************96 PP
>> tr|A0A1X7VSR7|A0A1X7VSR7_AMPQE Uncharacterized protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? 14.9 0.0 9.8e-06 0.053 10 29 .. 59 78 .. 55 84 .. 0.88
Alignments for each domain:
== domain 1 score: 14.9 bits; conditional E-value: 9.8e-06
zf-GRF 10 vlltvrktgpNkGRkFYkCp 29
+l+vrk+++ R FY+C
tr|A0A1X7VSR7|A0A1X7VSR7_AMPQE 59 NVLVVRKEREQTNRDFYVCR 78
689****************6 PP
>> tr|A0A1X7TBJ0|A0A1X7TBJ0_AMPQE Uncharacterized protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? 13.4 0.7 2.7e-05 0.15 2 23 .. 446 467 .. 445 468 .. 0.94
Alignments for each domain:
== domain 1 score: 13.4 bits; conditional E-value: 2.7e-05
zf-GRF 2 lCkcgrlavlltvrktgpNkGR 23
C c ++++ +v+++g+N+G+
tr|A0A1X7TBJ0|A0A1X7TBJ0_AMPQE 446 YCLCKHRSTTHVVQRNGKNQGQ 467
5*******************96 PP
>> tr|A0A1X7UY93|A0A1X7UY93_AMPQE Uncharacterized protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? 13.5 0.5 2.5e-05 0.14 15 44 .. 28 53 .. 26 54 .. 0.87
Alignments for each domain:
== domain 1 score: 13.5 bits; conditional E-value: 2.5e-05
zf-GRF 15 rktgpNkGRkFYkCpkgkekqCgFFkWade 44
+++g NkG ++kC g F W d+
tr|A0A1X7UY93|A0A1X7UY93_AMPQE 28 KNDGSNKGMTYFKCKDKH----GVFVWRDK 53
689***********9888....68999886 PP
>> tr|A0A1X7UGJ6|A0A1X7UGJ6_AMPQE Uncharacterized protein OS=Amphimedon queenslandica OX=400682 PE=3 SV=1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? 10.4 0.5 0.00024 1.3 26 44 .. 478 493 .. 477 494 .. 0.90
Alignments for each domain:
== domain 1 score: 10.4 bits; conditional E-value: 0.00024
zf-GRF 26 YkCpkgkekqCgFFkWade 44
++Cp g++ gFFkW d+
tr|A0A1X7UGJ6|A0A1X7UGJ6_AMPQE 478 WRCPEGRK---GFFKWTDS 493
58*****9...******97 PP
Internal pipeline statistics summary:
-------------------------------------
Query model(s): 1 (45 nodes)
Target sequences: 43435 (14716620 residues searched)
Passed MSV filter: 1789 (0.041188); expected 868.7 (0.02)
Passed bias filter: 859 (0.0197767); expected 868.7 (0.02)
Passed Vit filter: 68 (0.00156556); expected 43.4 (0.001)
Passed Fwd filter: 10 (0.000230229); expected 0.4 (1e-05)
Initial search space (Z): 43435 [actual number of targets]
Domain search space (domZ): 8 [number of targets reported over threshold]
# CPU time: 0.14u 0.01s 00:00:00.15 Elapsed: 00:00:00.09
# Mc/sec: 7358.31
//
[ok]