# hmmsearch :: search profile(s) against a sequence database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: pfam_list/zf-GRF.hmm.txt # target sequence database: proteomes/Monosiga_brevicollis.fasta # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: zf-GRF [M=45] Accession: PF06839.12 Description: GRF zinc finger Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-13 49.0 10.3 1.6e-08 33.6 1.3 3.2 2 tr|A9V1D2|A9V1D2_MONBE Predicted protein OS=Monosiga brevico Domain annotation for each sequence (and alignments): >> tr|A9V1D2|A9V1D2_MONBE Predicted protein OS=Monosiga brevicollis OX=81824 GN=32733 PE=4 SV=1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.6 1.3 1.7e-12 1.6e-08 2 43 .. 846 885 .. 845 887 .. 0.94 2 ! 18.7 2.0 7.7e-08 0.0007 2 21 .. 908 927 .. 907 928 .. 0.94 Alignments for each domain: == domain 1 score: 33.6 bits; conditional E-value: 1.7e-12 zf-GRF 2 lCkcgrlavlltvrktgpNkGRkFYkCpkgkekqCgFFkWad 43 C cg +a +lt+ t N G+ F+ C ++ + C+FF W+d tr|A9V1D2|A9V1D2_MONBE 846 PCFCGVPALRLTAA-TQANAGQSFFSCVNRTD-GCNFFSWVD 885 7************8.****************8.8******99 PP == domain 2 score: 18.7 bits; conditional E-value: 7.7e-08 zf-GRF 2 lCkcgrlavlltvrktgpNk 21 C+cg++av++tvrk+gpN+ tr|A9V1D2|A9V1D2_MONBE 908 CCNCGQPAVTRTVRKEGPNQ 927 6******************7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (45 nodes) Target sequences: 9188 (5511963 residues searched) Passed MSV filter: 274 (0.0298215); expected 183.8 (0.02) Passed bias filter: 162 (0.0176317); expected 183.8 (0.02) Passed Vit filter: 12 (0.00130605); expected 9.2 (0.001) Passed Fwd filter: 1 (0.000108838); expected 0.1 (1e-05) Initial search space (Z): 9188 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.04 # Mc/sec: 6200.96 // [ok]